DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and CG7514

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:294 Identity:69/294 - (23%)
Similarity:118/294 - (40%) Gaps:22/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 VEGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQ---TFPEAYRGMLDCFLSTYRKDGVLRGLYAGS 228
            :.|.:.::.|.|.|.....:.||||.||.::|   |..| |:...||.|..::.:|:| .||.| 
  Fly    10 IPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQISATTGE-YKSSFDCLLKVFKNEGIL-ALYNG- 71

  Fly   229 VPAVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKC 293
               :.|.:...:....|..|..:.......|:.....|.:.:...|.||..|..:...|.|:...
  Fly    72 ---LSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALI 133

  Fly   294 KLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTR 358
            ::.:    .|.:.||..::..........|.:.||:...::|...|..|.|........||...:
  Fly   134 RMMS----DNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLK 194

  Fly   359 ELLRRDDQSKDDIGPLRTMIAGA-IGGVCLWTSTFPADVIKSRIQVKNLNE--SMFAVGADIVRR 420
            ...      .:....|...||.| :.|:....::.|.|:.|:|||.:...|  ....|...:.:.
  Fly   195 AAF------SEYFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKN 253

  Fly   421 EGVLALYRGLLPSVLRTIPATATLFVVYEYTKRA 454
            ||:.:|::|..|.:.|..|.|...|:..|...:|
  Fly   254 EGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 69/294 (23%)
Mito_carr 170..252 CDD:278578 24/84 (29%)
Mito_carr 263..364 CDD:278578 19/100 (19%)
Mito_carr 369..455 CDD:278578 24/89 (27%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 67/286 (23%)
Mito_carr 19..90 CDD:278578 24/76 (32%)
Mito_carr 104..201 CDD:278578 19/106 (18%)
Mito_carr 207..284 CDD:278578 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.