DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Tpc2

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:318 Identity:74/318 - (23%)
Similarity:134/318 - (42%) Gaps:57/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPE--------AYRGMLDCFLSTYRKDGVLRGLYA 226
            |:..:.|.:.|||...::||||.:|::.|...|        .|||::..|.|.|.::| :||::.
  Fly    10 LMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEG-MRGMFR 73

  Fly   227 GSVPAVFANVAENSVLFAAYGGCQK------------FVAFCVGKETAGDLTTVQNACAGSLAAC 279
            |.......:::...|.|.:|...:.            |:.|.:               .|.:|.|
  Fly    74 GHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFI---------------CGGIAGC 123

  Fly   280 FSTLTLCPTELIKCKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREM 344
            ...:...|.::::.::.|       .:|:..:.....:|..|.:::.||..|..|||..|.::..
  Fly   124 LGAVAAQPFDVVRTQMVA-------ADPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVF 181

  Fly   345 P--GYFFFFGSYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLN 407
            |  |..|.|..|.....|:.:....:.:|......:.||:.||......:|||::|.|||:....
  Fly   182 PLVGANFLFYKYLNAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFK 246

  Fly   408 ESMFAVGAD------------IVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKR 453
            :.....|.:            ..|.||:...|:|:||::|:....:|..|.:|:..||
  Fly   247 QERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 74/318 (23%)
Mito_carr 170..252 CDD:278578 25/101 (25%)
Mito_carr 263..364 CDD:278578 21/102 (21%)
Mito_carr 369..455 CDD:278578 26/97 (27%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 67/303 (22%)
Mito_carr 23..99 CDD:278578 20/76 (26%)
Mito_carr 108..194 CDD:278578 21/107 (20%)
Mito_carr 216..307 CDD:278578 25/89 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.