DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Shawn

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:120/277 - (43%) Gaps:70/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GLYAGSVPAVFANVAENSVLFAAYGGCQKFVAFCVGKETAGD-------LTTVQNACAGSL-AAC 279
            |.:|.:..|:.|..::|.                 .|.|..|       |..|.:||.|:: .||
  Fly     8 GQFAAASAAMAAASSQNP-----------------SKATMTDPRFRIRPLQQVASACTGAMVTAC 55

  Fly   280 FSTLTLCPTELIKCKLQALRE-------------MKNFVEPAHPQDIRTP----------WTLTR 321
            |.|    |.::||.:|||.::             :.:.:.|..| |...|          .|:..
  Fly    56 FMT----PLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGP-DTPNPAAAKPAPRFSGTIDA 115

  Fly   322 Y--IWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTR--------ELLRRDDQSKDDIGP--- 373
            :  |.|||||...:.|||.|.:..:|....:|.:||..:        :..||.|....|| |   
  Fly   116 FIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDI-PHPI 179

  Fly   374 --LRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNES-MFAVGADIVRREGVLALYRGLLPSVL 435
              |..::||..|.:...|...|.::|::::|.:.:..: ||.....:|:.:|||.|:|||.|::|
  Fly   180 PFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRMTHAEMFGTIRQVVQSQGVLGLWRGLPPTIL 244

  Fly   436 RTIPATATLFVVYEYTK 452
            |.:|.:...:..|||.|
  Fly   245 RDVPFSGIYWTCYEYLK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 74/277 (27%)
Mito_carr 170..252 CDD:278578 5/28 (18%)
Mito_carr 263..364 CDD:278578 36/141 (26%)
Mito_carr 369..455 CDD:278578 29/90 (32%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 34/124 (27%)
Mito_carr 178..265 CDD:278578 26/84 (31%)
Mito_carr 268..371 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.