DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and sea

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:310 Identity:81/310 - (26%)
Similarity:138/310 - (44%) Gaps:41/310 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 HGGGTGNNINFVEGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQT----FPEAYRGMLDCFLSTYR 216
            ||....::...  ||...:||.:.|..::.::.|.:.||.:||.    ..:.|.|:.||...|..
  Fly    22 HGAAAADSGQV--GLKGIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVG 84

  Fly   217 KDGVLRGLYAGSVPAVFANVAENSVLFAAYGGCQKFVAFCVGK-ETAGDLTTVQNACAGSLAACF 280
            :.|.| |||.|....|:.::.:::..|.|:...:.......|: ..:|.|     .|......|.
  Fly    85 ERGFL-GLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKL-----LCGLGAGVCE 143

  Fly   281 STLTLCPTELIKCKLQALREMKN----FVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFL 341
            :.:.:.|.|.||.|.  :.:.::    |...||.         ...|.::|||.|.|:||:.|.|
  Fly   144 AIVAVTPMETIKVKF--INDQRSGNPKFRGFAHG---------VGQIIKSEGISGIYKGLTPTIL 197

  Fly   342 REMPGYFFFFGSYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTF---PADVIKSRIQ- 402
            ::.......|...|..::|.:.||.:|    |:..::.|..|.:....|.|   |.||:|:|:| 
  Fly   198 KQGSNQAIRFFVLESLKDLYKGDDHTK----PVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQG 258

  Fly   403 ---VKNLNESMFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYE 449
               .|..|.:..||  :|::.||..|.|:|.:|.:.|.....|..|::|:
  Fly   259 LEASKYKNTAHCAV--EILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 79/304 (26%)
Mito_carr 170..252 CDD:278578 23/85 (27%)
Mito_carr 263..364 CDD:278578 25/104 (24%)
Mito_carr 369..455 CDD:278578 26/88 (30%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 76/290 (26%)
Mito_carr 34..117 CDD:278578 23/83 (28%)
Mito_carr 125..220 CDD:278578 26/110 (24%)
Mito_carr 235..314 CDD:278578 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.