DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and CG9582

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:295 Identity:82/295 - (27%)
Similarity:133/295 - (45%) Gaps:38/295 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 FLAGSLGGAAQVYVSQPLDTVKVKLQ---TFP----EAYRGMLDCFLSTYRKDGVLRGLYAGSVP 230
            ||||.|.|..::....|||.||.::|   ..|    ..|...||..:..||.:| |..|:.|.||
  Fly    17 FLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEG-LSSLWKGIVP 80

  Fly   231 AVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKL 295
            .:.....:....|..|...:.:..|     .|...|.:.:|.:||:||...:..:.|.|::|...
  Fly    81 PICVETPKRGGKFLMYESLKPYFQF-----GAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQ 140

  Fly   296 QALREMKNFVEPAHPQDIRTPWTLTRYIWRTE--GIRGFYRGLSSTFLREMPGYFFFFGSYEGTR 358
            ||.|..:          ::| .::.:||.:.:  ||:|.|||:::...|....:|.|||.|...:
  Fly   141 QAHRGKR----------LKT-LSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALK 194

  Fly   359 ELLRRDDQSKDDIGPLRTMIAGAIGG--VCLWTSTFPADVIKSRIQ----VKNLNESMFAVGA-- 415
            :::...:....:|  ||.:|...:..  .|:.:.|.  |:.|.|||    ||...:..:.:..  
  Fly   195 DIVPSPEDKTYNI--LRKVIIAGLASSLACVMSVTL--DMAKCRIQGPQPVKGEVKYQWTISTIK 255

  Fly   416 DIVRREGVLALYRGLLPSVLRTIPATATLFVVYEY 450
            ...:.||..:|::||...:||..|..|.|.|.|||
  Fly   256 STFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEY 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 82/295 (28%)
Mito_carr 170..252 CDD:278578 26/85 (31%)
Mito_carr 263..364 CDD:278578 27/102 (26%)
Mito_carr 369..455 CDD:278578 27/90 (30%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 82/295 (28%)
Mito_carr 17..104 CDD:278578 26/87 (30%)
Mito_carr 109..196 CDD:278578 27/97 (28%)
Mito_carr 216..295 CDD:278578 23/77 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.