DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Ucp4B

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:301 Identity:70/301 - (23%)
Similarity:128/301 - (42%) Gaps:30/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 FLAGSLGGAAQVYVSQPLDTVKVKLQTFPE---------AYRGMLDCFLSTYRKDGVLRGLYAGS 228
            :|.......:...|..|.|..|.::|...|         .|||:|...:...|::|:|: ||.|.
  Fly    40 YLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLK-LYGGI 103

  Fly   229 VPAVFANVAENSVLFAAYGGC-QKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIK 292
            ...:|.:...:.:....|... :|.:.  ..::....|:.:.:..:|.||...:::...||||||
  Fly   104 SAMLFRHSLFSGIKMLTYDYMREKMIV--PDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIK 166

  Fly   293 CKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGT 357
            .::|...:.:...||....::....|   .|:||.|:.|.::|......|...........|:..
  Fly   167 IQMQMEGQRRLRGEPPRIHNVLQALT---SIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFC 228

  Fly   358 RELLRRDDQSKD--DIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVG------ 414
            :..|..:....|  ::..:..|.||....:.    :.||||:||||..:..:|....:.      
  Fly   229 KRFLIAEFDLVDNREVQFVAAMTAGVADAIL----SLPADVVKSRIMNQPTDEQGRGIHYKGSLD 289

  Fly   415 --ADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKR 453
              :.:||.||.||:|:|.:|..:|..||:...::.:|..:|
  Fly   290 CLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 70/301 (23%)
Mito_carr 170..252 CDD:278578 19/88 (22%)
Mito_carr 263..364 CDD:278578 23/100 (23%)
Mito_carr 369..455 CDD:278578 27/95 (28%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 63/275 (23%)
Mito_carr 32..129 CDD:278578 20/89 (22%)
Mito_carr 138..233 CDD:278578 22/97 (23%)
Mito_carr 246..331 CDD:278578 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.