DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Ucp4C

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:307 Identity:76/307 - (24%)
Similarity:129/307 - (42%) Gaps:52/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 QVYVSQ------------PLDTVKVKLQTFPE----------AYRGMLDCFLSTYRKDGVLRGLY 225
            |:||:.            |||..|.::|...|          .:|..|   .:..|.:| .:.||
  Fly    38 QLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATL---TNMIRVEG-FKSLY 98

  Fly   226 AGSVPAVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSL-AACFSTLTLCPTE 289
            ||....|..|...||:....|...::  .|....|...::..:..|...|. |.|.:.....|.:
  Fly    99 AGFSAMVTRNFIFNSLRVVLYDVFRR--PFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFD 161

  Fly   290 LIKCKLQALREMKNFVEPAHPQDIRTPWTLTRY--IWRTEGIRGFYRGLSSTFLREMPGYFFFFG 352
            ::|.::|.....:..     ..|:|....:..:  |:|..|:...::|:..:.:|.........|
  Fly   162 IVKVRMQTEGRRRQL-----GYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVG 221

  Fly   353 SYEGTRELLRRDDQSKDDIGPLR---TMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNES----M 410
            ||:.::...:|....::.: |||   :|.||....|   .|| ||||||||:..:.::||    .
  Fly   222 SYDISKRTFKRLLDLEEGL-PLRFVSSMCAGLTASV---LST-PADVIKSRMMNQPVDESGKNLY 281

  Fly   411 FAVGAD----IVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKR 453
            :....|    :||.||||.||:||:|:..|..|.:...::..|..::
  Fly   282 YKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQ 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 76/307 (25%)
Mito_carr 170..252 CDD:278578 22/90 (24%)
Mito_carr 263..364 CDD:278578 17/103 (17%)
Mito_carr 369..455 CDD:278578 34/96 (35%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 19/78 (24%)
Mito_carr 137..232 CDD:278578 17/99 (17%)
Mito_carr 237..329 CDD:278578 34/97 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.