DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Slc25a48

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_808477.2 Gene:Slc25a48 / 328258 MGIID:2145373 Length:306 Species:Mus musculus


Alignment Length:300 Identity:95/300 - (31%)
Similarity:149/300 - (49%) Gaps:22/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAG-SVPAVF 233
            |.||:||.:||.|.|.|..||||||.:||. ...|....:|....|:::.|. |.:.| |.|  .
Mouse     6 LEDFVAGWIGGVASVIVGYPLDTVKTRLQA-GVGYANTFNCIRMVYKRERVF-GFFKGMSFP--L 66

  Fly   234 ANVA-ENSVLFAAYGGCQKFVA-FCVGKETAGDLTTVQNACAGSLAACFSTLTL-CPTELIKCKL 295
            |::| .|||:|..:...|:|:: :..|:..||...::.:....|:.....::.| .|.||||.:|
Mouse    67 ASIAIYNSVVFGVFSNTQRFLSKYRCGELEAGPGRSLSDLLLASMLTGVVSVGLGGPVELIKIRL 131

  Fly   296 QALREMKNFVEPAHPQDIRT------PWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSY 354
            |  .:.:.|.|.:|....|.      |......|.:.||:.|.|||.|:..||::|||.|:|..|
Mouse   132 Q--MQTQPFREASHGLKSRAVAAYQGPVHCIATIVQMEGLTGLYRGASAMLLRDIPGYCFYFIPY 194

  Fly   355 EGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVGADIV- 418
            ....|.:  ..::.....|....:||.|.|...|.:..|.||:|||||...:..:.:....|.: 
Mouse   195 VFLSEWI--TPEACTGPSPYAAWLAGGIAGAISWGTATPMDVVKSRIQADGVYLNKYRGVVDCIS 257

  Fly   419 ---RREGVLALYRGLLPSVLRTIPATATLFVVYEYTKRAL 455
               ::||....:||:..:.:|..|.:|.:|:.||.:.:||
Mouse   258 QSYQQEGFKVFFRGITVNAVRGFPMSAAMFLGYELSLKAL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 93/298 (31%)
Mito_carr 170..252 CDD:278578 33/83 (40%)
Mito_carr 263..364 CDD:278578 32/107 (30%)
Mito_carr 369..455 CDD:278578 25/89 (28%)
Slc25a48NP_808477.2 Solcar 1 3..86 33/83 (40%)
Mito_carr 6..89 CDD:365909 34/86 (40%)
Solcar 2 101..200 30/100 (30%)
Mito_carr 107..202 CDD:365909 31/98 (32%)
Mito_carr 209..299 CDD:365909 26/88 (30%)
Solcar 3 209..296 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.