DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and Ant2

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:330 Identity:73/330 - (22%)
Similarity:141/330 - (42%) Gaps:62/330 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 GGGTGNNINFVEG-LIDFLAGSLGGAAQVYVSQPLDTVKVKLQ--------TFPEAYRGMLDCFL 212
            |||.|:....::. |:||:.|.:..|.......|::.||:.||        ...:.|:|::|||:
  Fly     5 GGGGGHGKGDLKSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFI 69

  Fly   213 STYRKDG---VLRGLYAGSV---PAVFANVAENSVLFAAY-GGCQKFVAFCVGKETAGDLTTVQN 270
            ...::.|   ..||..|..:   |....|.|...|..:.: ||..|...|  .:..||:|.:  .
  Fly    70 RIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQF--WRHFAGNLAS--G 130

  Fly   271 ACAGSLAACFSTLTLCPTELIKCKLQA------LREMKNFVEPAHPQDIRTPWTLTRYIWRTEGI 329
            ..||:.:.||    :.|.:..:.:|.|      .||....::           .|.:.| :::|.
  Fly   131 GAAGATSLCF----VYPLDFARTRLAADVGKGGNREFNGLID-----------CLMKVI-KSDGP 179

  Fly   330 RGFYRGLSSTFLREMPGYFF----FFGSYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTS 390
            .|.|||    |:..:.|...    :||.|:..|:.|.....:...:......:...:.|:    :
  Fly   180 IGLYRG----FIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWAIAQVVTTVAGI----A 236

  Fly   391 TFPADVIKSRIQVKN---LNESMFAVGAD----IVRREGVLALYRGLLPSVLRTIPATATLFVVY 448
            ::|.|.::.|:.:::   .:|.::...|.    |.::||:.|.::|.|.:::|. ...|.:..:|
  Fly   237 SYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRG-TGGALVLALY 300

  Fly   449 EYTKR 453
            :..|:
  Fly   301 DEMKK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 69/325 (21%)
Mito_carr 170..252 CDD:278578 25/96 (26%)
Mito_carr 263..364 CDD:278578 25/110 (23%)
Mito_carr 369..455 CDD:278578 16/92 (17%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 68/318 (21%)
Mito_carr 17..111 CDD:278578 23/93 (25%)
Mito_carr 119..215 CDD:278578 27/119 (23%)
Mito_carr 218..307 CDD:278578 16/93 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.