DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and CG5254

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:299 Identity:81/299 - (27%)
Similarity:135/299 - (45%) Gaps:41/299 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LAGSLGGAAQVYVSQPLDTVKVKLQ----TFPEA-------YRGMLDCFLSTYRKDGVLRGLYAG 227
            |||...|..:|.:.||||.||.::|    ..|.|       |.|:.|||...||.:|: ...:.|
  Fly    19 LAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGI-SSYWKG 82

  Fly   228 SVPAVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIK 292
            .:|.:.|...:.::.|..:...:....|  |..|...||.   :.||..|.....:.:.|.|::|
  Fly    83 IMPPILAETPKRAIKFLVFEQTKPLFQF--GSPTPTPLTF---SLAGLTAGTLEAIAVNPFEVVK 142

  Fly   293 CKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGI--RGFYRGLSSTFLREMPGYFFFFGSYE 355
            ...||.|:.|          :.:.:.:.:.|.:.:|:  .|..:|:::|..|.......:||.|.
  Fly   143 VAQQADRQKK----------MLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYH 197

  Fly   356 GTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRI--------QVKNLNESMFA 412
            ..:.::....:|..:.  ||.:..|.:.|........|.||.||||        |:| ...::.:
  Fly   198 SVKNVVPEYKESHLEF--LRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIK-YRGTLSS 259

  Fly   413 VGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYT 451
            :|. :.|.||..|||:||:|.::|..|..|.|.:|:||:
  Fly   260 MGI-VYREEGFRALYKGLVPKIMRLGPGGAILLLVFEYS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 81/299 (27%)
Mito_carr 170..252 CDD:278578 26/88 (30%)
Mito_carr 263..364 CDD:278578 21/102 (21%)
Mito_carr 369..455 CDD:278578 30/91 (33%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 27/95 (28%)
PTZ00169 19..301 CDD:240302 81/299 (27%)
Mito_carr 122..207 CDD:278578 19/94 (20%)
Mito_carr 209..305 CDD:278578 31/93 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.