DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and SLC25A45

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001339310.2 Gene:SLC25A45 / 283130 HGNCID:27442 Length:288 Species:Homo sapiens


Alignment Length:297 Identity:92/297 - (30%)
Similarity:139/297 - (46%) Gaps:31/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAG-SVPAVFAN 235
            :|:||.:.||..:.:..|.|||||:||| ...|||::||.:..||.:.:| |.:.| |.|  .|:
Human     5 EFVAGWISGALGLVLGHPFDTVKVRLQT-QTTYRGIVDCMVKIYRHESLL-GFFKGMSFP--IAS 65

  Fly   236 VA-ENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQN----ACAGSLAACFSTLTLCPTELIKCKL 295
            :| .|||||..|......:.....:|......:..:    .|.|.....:   .|.|.:|||.:|
Human    66 IAVVNSVLFGVYSNTLLVLTATSHQERRAQPPSYMHIFLAGCTGGFLQAY---CLAPFDLIKVRL 127

  Fly   296 QALREMKNFVEP-----AHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYE 355
            |      |..||     :.|...:.|......|:|.||.||.:||..:..||:.|....:|.:||
Human   128 Q------NQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYE 186

  Fly   356 GTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVGADI--- 417
            |   |.|:......:......::||...|:..|.:..|.|:||||:|:..|...::....|.   
Human   187 G---LCRQYTPEGQNPSSATVLVAGGFAGIASWVAATPLDMIKSRMQMDGLRRRVYQGMLDCMVS 248

  Fly   418 -VRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKR 453
             :|:||:...:||:..:..|..|..|..|:.|||..|
Human   249 SIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEYLLR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 92/297 (31%)
Mito_carr 170..252 CDD:278578 34/81 (42%)
Mito_carr 263..364 CDD:278578 31/109 (28%)
Mito_carr 369..455 CDD:278578 26/89 (29%)
SLC25A45NP_001339310.2 Solcar 1 1..83 34/81 (42%)
Mito_carr 2..77 CDD:395101 33/75 (44%)
Mito_carr 95..186 CDD:395101 26/99 (26%)
Solcar 2 97..191 30/105 (29%)
Mito_carr 197..288 CDD:395101 26/89 (29%)
Solcar 3 199..286 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.