DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and R07B7.10

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_506030.2 Gene:R07B7.10 / 187658 WormBaseID:WBGene00011094 Length:285 Species:Caenorhabditis elegans


Alignment Length:296 Identity:101/296 - (34%)
Similarity:144/296 - (48%) Gaps:35/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAVFANV 236
            ||:||...|.|.:.|..||||||.:|||. ..|:|::||.:.|.:::.|. |||.|......:..
 Worm     4 DFIAGWAAGGAGLLVGHPLDTVKARLQTM-NIYKGIVDCMVKTMKQESVY-GLYKGMFVPFISTG 66

  Fly   237 AENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGS--------LAACFSTLT----LCPTE 289
            |.:|:|||.||...||:       ..||    .|..|..        :|:...||.    :.|.|
 Worm    67 ALHSLLFAGYGAGLKFL-------NPGD----SNVMARKDLPMSDILIASICGTLVQVGPVIPVE 120

  Fly   290 LIKCKLQALRE-MKNFVEPAHPQDIRT-PWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFG 352
            |:|.|||..|| :.:|.:  |.:::.. |....|...|.||:||.::|.|..|.|:..||.|:..
 Worm   121 LLKTKLQVQRENIGHFSK--HSRNLYAGPLECARETVRAEGVRGLFKGGSVVFCRDNIGYLFYIP 183

  Fly   353 SYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMF--AVGA 415
            .|||    |.|..:|.:.......:.||...||..|.|..|.:|:|:|||....::::.  .:..
 Worm   184 VYEG----LSRYFRSHNLENTWTQLFAGGCAGVSGWISVCPLEVVKNRIQADKSHKTLSPKEMTL 244

  Fly   416 DIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYT 451
            .|.|.:|:.|.|||.....||.....|.:|||||.|
 Worm   245 KIYREDGLRAFYRGGWAISLRGFVVNAVIFVVYENT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 101/296 (34%)
Mito_carr 170..252 CDD:278578 33/79 (42%)
Mito_carr 263..364 CDD:278578 36/114 (32%)
Mito_carr 369..455 CDD:278578 28/85 (33%)
R07B7.10NP_506030.2 Mito_carr <17..83 CDD:278578 28/67 (42%)
Mito_carr 94..196 CDD:278578 34/107 (32%)
Mito_carr 199..284 CDD:278578 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.