DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and dif-1

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001379917.1 Gene:dif-1 / 177530 WormBaseID:WBGene00000996 Length:312 Species:Caenorhabditis elegans


Alignment Length:305 Identity:101/305 - (33%)
Similarity:153/305 - (50%) Gaps:40/305 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFP-------EAYRGMLDCFLSTYRKDGVLRGLYAG 227
            |::|:||.:||:..|.|..|.|||||::||.|       ..:.|.|||...|..|:|.. .||.|
 Worm     5 LLNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKEGFF-ALYKG 68

  Fly   228 -SVPAVFANVAENSVLFAA-YGGCQKFVAFCVGK-----ETAGDLTTVQNACAGSLAACFSTLTL 285
             :.|.|..     |.|||. :|||      .|||     :.:.::|.:|||.||:||..|:|:.:
 Worm    69 MAAPLVGV-----SPLFAVFFGGC------AVGKWLQQTDPSQEMTFIQNANAGALAGVFTTIVM 122

  Fly   286 CPTELIKCKLQALREMKNFVEPAH---PQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGY 347
            .|.|.|||.|| :::..:.....|   |.|:      .:.:::..||...|||..:|.||::|..
 Worm   123 VPGERIKCLLQ-VQQAGSAGSGVHYDGPLDV------VKKLYKQGGISSIYRGTGATLLRDIPAS 180

  Fly   348 FFFFGSYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVK---NLNES 409
            ..:...||..::....:...: .:.|..|::||.:.|:..|....||||:|||:|..   ...:.
 Worm   181 AAYLSVYEYLKKKFSGEGAQR-TLSPGATLMAGGLAGIANWGVCIPADVLKSRLQTAPEGKYPDG 244

  Fly   410 MFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKRA 454
            :..|..:::|.||..||::|..|.:||..||.|..|...|.|..|
 Worm   245 IRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFFGLELTLAA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 101/305 (33%)
Mito_carr 170..252 CDD:278578 36/90 (40%)
Mito_carr 263..364 CDD:278578 31/103 (30%)
Mito_carr 369..455 CDD:278578 31/89 (35%)
dif-1NP_001379917.1 Mito_carr 4..85 CDD:395101 33/85 (39%)
Mito_carr 100..198 CDD:395101 31/104 (30%)
Mito_carr 202..291 CDD:395101 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.