DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and slc25a45

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_012816001.1 Gene:slc25a45 / 100127755 XenbaseID:XB-GENE-1006763 Length:332 Species:Xenopus tropicalis


Alignment Length:298 Identity:86/298 - (28%)
Similarity:131/298 - (43%) Gaps:42/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GGAAQVYVSQPLDTV----KVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAVFANVAEN 239
            ||||:   ...|:.:    .|:||| ...|||:|||.:.|||.:.:. |.:.|....|.:....|
 Frog    53 GGAAR---KDELEEICCLSLVRLQT-QSRYRGILDCVIQTYRNETIF-GFFKGMSFPVGSVAISN 112

  Fly   240 SVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLT----LCPTELIKCKLQALRE 300
            |:.|.:|.....:::    .:...:.....:.|...:|.|||.:.    ..|.:|:|.:||...|
 Frog   113 SLAFGSYSNALLYLS----DQEIKNWKNPPHNCHVFMAGCFSGIVQLSFSAPVDLVKVRLQNQTE 173

  Fly   301 -MKNFVEPAHPQDIRTPWTLTRY---------IWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYE 355
             ..|...|.|.|        .||         |:|.|||.|.|||..:..||::|....:|.:||
 Frog   174 SFGNQARPGHLQ--------ARYQGPVHCAVCIFREEGIFGLYRGCLALALRDIPSMGLYFLTYE 230

  Fly   356 GTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVGADIVRR 420
               .|.:...:|.|:......:.||...|...|....|.||||:|:|:..::...:....|.:|:
 Frog   231 ---VLCKWMTKSLDEPSAWTMLFAGGCAGTVGWAFANPMDVIKARLQMDGMHGVQYLGMLDCIRK 292

  Fly   421 ----EGVLALYRGLLPSVLRTIPATATLFVVYEYTKRA 454
                |||....:||..:.||..|..|..|:.||...:|
 Frog   293 SIRQEGVKVFLKGLTINSLRAFPVNAVTFLSYEMLLKA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 86/298 (29%)
Mito_carr 170..252 CDD:278578 25/76 (33%)
Mito_carr 263..364 CDD:278578 33/114 (29%)
Mito_carr 369..455 CDD:278578 27/90 (30%)
slc25a45XP_012816001.1 Mito_carr <70..128 CDD:278578 20/63 (32%)
Mito_carr 144..240 CDD:278578 32/106 (30%)
Mito_carr 241..332 CDD:278578 27/90 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.