DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1628 and slc25a15.2

DIOPT Version :9

Sequence 1:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001090866.1 Gene:slc25a15.2 / 100038284 XenbaseID:XB-GENE-973185 Length:302 Species:Xenopus tropicalis


Alignment Length:292 Identity:139/292 - (47%)
Similarity:191/292 - (65%) Gaps:6/292 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 VEGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPA 231
            ::..||..||:.||.|.|...||.||.|||:||||..|||::||.:.|||:.| |||.|.|:.||
 Frog     7 IQAAIDLTAGAAGGTACVLTGQPFDTAKVKMQTFPTMYRGLMDCAVKTYRQMG-LRGFYRGTSPA 70

  Fly   232 VFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKLQ 296
            :.||:|||||||.:||.|||.|...||.:...:|:.||||.:||:|:.|:.|.||||||:||:||
 Frog    71 LLANIAENSVLFMSYGFCQKVVRQIVGLDKNAELSDVQNAASGSVASIFAALVLCPTELVKCRLQ 135

  Fly   297 ALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTRELL 361
            |:.|::  |.....|...|.|::.:.|.:.||...||.||:||..|||||||.|||.||.:|...
 Frog   136 AMHELQ--VSGKILQGQNTVWSVVKGIVQREGPLAFYNGLTSTICREMPGYFLFFGGYEASRSFF 198

  Fly   362 RRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLN---ESMFAVGADIVRREGV 423
            ....:|||::||:..:::|..||:.||.:.:|.|.:||||||.:::   .........||:.|||
 Frog   199 ASGGKSKDELGPMALIVSGGFGGIALWLAVYPIDCVKSRIQVLSISGKQAGFMKTFLHIVKNEGV 263

  Fly   424 LALYRGLLPSVLRTIPATATLFVVYEYTKRAL 455
            ||||.||.|:::|..||...||:.|||::|.:
 Frog   264 LALYSGLKPTLIRAFPANGALFLAYEYSRRLM 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 139/290 (48%)
Mito_carr 170..252 CDD:278578 48/81 (59%)
Mito_carr 263..364 CDD:278578 48/100 (48%)
Mito_carr 369..455 CDD:278578 37/88 (42%)
slc25a15.2NP_001090866.1 Mito_carr 9..93 CDD:365909 49/84 (58%)
Mito_carr 104..198 CDD:365909 48/95 (51%)
Mito_carr 208..297 CDD:365909 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6957
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45624
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2214
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.