DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA2 and btn

DIOPT Version :10

Sequence 1:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:94 Identity:47/94 - (50%)
Similarity:58/94 - (61%) Gaps:5/94 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   120 AATGPACLSHKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTE 184
            |.||....|.:..|...    ..:|:.|||::.|||.:||.||.::.||.|.||.|||..|:|||
  Fly    67 APTGQELPSQRSKLRAI----SSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTE 127

Human   185 RQVKVWFQNRRMKHKRQTQCKENQNSEGK 213
            |||||||||||||.|| .:.:|.|.|..|
  Fly   128 RQVKVWFQNRRMKCKR-IKLEEQQGSSAK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93
Antp-type hexapeptide 94..99
Homeodomain 144..200 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 6/16 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
btnNP_732768.1 Homeodomain 87..143 CDD:459649 36/55 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.