DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA2 and CG18599

DIOPT Version :10

Sequence 1:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster


Alignment Length:239 Identity:65/239 - (27%)
Similarity:87/239 - (36%) Gaps:108/239 - (45%)


- Green bases have known domain annotations that are detailed below.


Human    67 HGAGGRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACL---- 127
            ||....|.|..||.                               ||.|||..||  |:.|    
  Fly   252 HGGHQHPHPHQAGF-------------------------------AAVAAAVGAA--PSALQSLQ 283

Human   128 ------------------------SHKES-LEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKY 167
                                    |||:| |:        ::|:||.:|..||..||.||...:|
  Fly   284 QLHQQHHAQQQATLSFQREKLKSDSHKKSALK--------NKRVRTIFTPEQLECLEAEFERQQY 340

Human   168 LCRPRRVEIAALLDLTERQVKVWFQNRRMKHK--------------RQTQCK------------- 205
            :..|.|:.:|..|.|||.||||||||||:|.:              ||||..             
  Fly   341 MVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLPGTSLLGNQVSVSA 405

Human   206 ------ENQNSEGKCKSLEDSEKVEEDEEEKTLFEQALSVSGAL 243
                  ..:.:.| |.:...|.:.|::|:.|    .:||:||||
  Fly   406 NAAHSVSTERTNG-CSAASPSLQEEDNEDSK----HSLSLSGAL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 6/25 (24%)
Antp-type hexapeptide 94..99 0/4 (0%)
Homeodomain 144..200 CDD:459649 29/69 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 9/63 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.