DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA2 and Ubx

DIOPT Version :9

Sequence 1:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:230 Identity:70/230 - (30%)
Similarity:93/230 - (40%) Gaps:57/230 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    60 NPGSHPRHGAGGRPKPSPAGSRGSPVPAG-------------------------------ALQPP 93
            :|.||....|||....|........|.:|                               |....
  Fly   174 SPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHT 238

Human    94 EYPWM-------KEKKAAKKTALLPAAAAAATAAATGPACLSHKESLE---IAD--GSGGGSRRL 146
            .||||       ::...:|..:.|......:|....     .:.|||.   :.|  |:.|..||.
  Fly   239 FYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGK-----RYSESLAGSLLPDWLGTNGLRRRG 298

Human   147 RTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSE 211
            |..||..|.||||||||.|.||.|.||:|:|..|.|||||:|:||||||||.|::.|.       
  Fly   299 RQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQA------- 356

Human   212 GKCKSLEDSEKVEEDEEEKTLFEQALSVSGALLER 246
              .|.|.:.||..:.::.......|.:|.|..|::
  Fly   357 --IKELNEQEKQAQAQKAAAAAAAAAAVQGGHLDQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 10/63 (16%)
Antp-type hexapeptide 94..99 4/11 (36%)
Homeobox 147..200 CDD:395001 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
UbxNP_536752.1 Homeobox 299..352 CDD:395001 35/52 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.