Sequence 1: | NP_006726.1 | Gene: | HOXA2 / 3199 | HGNCID: | 5103 | Length: | 376 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536752.1 | Gene: | Ubx / 42034 | FlyBaseID: | FBgn0003944 | Length: | 389 | Species: | Drosophila melanogaster |
Alignment Length: | 230 | Identity: | 70/230 - (30%) |
---|---|---|---|
Similarity: | 93/230 - (40%) | Gaps: | 57/230 - (24%) |
- Green bases have known domain annotations that are detailed below.
Human 60 NPGSHPRHGAGGRPKPSPAGSRGSPVPAG-------------------------------ALQPP 93
Human 94 EYPWM-------KEKKAAKKTALLPAAAAAATAAATGPACLSHKESLE---IAD--GSGGGSRRL 146
Human 147 RTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSE 211
Human 212 GKCKSLEDSEKVEEDEEEKTLFEQALSVSGALLER 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXA2 | NP_006726.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 42..93 | 10/63 (16%) | |
Antp-type hexapeptide | 94..99 | 4/11 (36%) | |||
Homeobox | 147..200 | CDD:395001 | 35/52 (67%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 198..229 | 6/30 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 257..279 | ||||
Ubx | NP_536752.1 | Homeobox | 299..352 | CDD:395001 | 35/52 (67%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |