DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA2 and Antp

DIOPT Version :9

Sequence 1:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:194 Identity:66/194 - (34%)
Similarity:78/194 - (40%) Gaps:70/194 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    26 PPVADTFQSSSIKTSTLSHSTLIPP------PFEQTIPSLNPGSHPRHGAGGRPKPSPAGSRGSP 84
            |||....|.       :.|....||      |.:.|.||.||.|.               |.|.|
  Fly   238 PPVGAPPQG-------MMHQGQGPPQMHQGHPGQHTPPSQNPNSQ---------------SSGMP 280

Human    85 VPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHKESLEIADGSGGGSRRLRTA 149
            .|.       ||||:.:..                     .|...|              |.|..
  Fly   281 SPL-------YPWMRSQFG---------------------KCQERK--------------RGRQT 303

Human   150 YTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGK 213
            ||..|.||||||||||:||.|.||:|||..|.|||||:|:||||||||.|::.:.|....|.|:
  Fly   304 YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 14/56 (25%)
Antp-type hexapeptide 94..99 3/4 (75%)
Homeobox 147..200 CDD:395001 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 27/131 (21%)
Homeobox 301..354 CDD:395001 37/52 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.