DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA2 and Scr

DIOPT Version :9

Sequence 1:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:152 Identity:60/152 - (39%)
Similarity:74/152 - (48%) Gaps:43/152 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    61 PG--SHPRHGAGGRPKPSPAGSRGSPVPAGALQ--------PPE-YPWMKEKKAAKKTALLPAAA 114
            ||  :.|.|..||....|.:.|...   ||:.|        ||: |||||.......|.      
  Fly   263 PGNVNVPMHSPGGGDSDSESDSGNE---AGSSQNSGNGKKNPPQIYPWMKRVHLGTSTV------ 318

Human   115 AAATAAATGPACLSHKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAAL 179
                                   .:.|.::|.||:||..|.||||||||||:||.|.||:|||..
  Fly   319 -----------------------NANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHA 360

Human   180 LDLTERQVKVWFQNRRMKHKRQ 201
            |.|||||:|:||||||||.|::
  Fly   361 LCLTERQIKIWFQNRRMKWKKE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 11/41 (27%)
Antp-type hexapeptide 94..99 3/5 (60%)
Homeobox 147..200 CDD:395001 38/52 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 38/52 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.