DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA2 and zen2

DIOPT Version :9

Sequence 1:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:294 Identity:83/294 - (28%)
Similarity:123/294 - (41%) Gaps:65/294 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    89 ALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHKESLEIADGSGGGSRRLRTAYTNT 153
            |:|...|  ..:..:.....:.|.......||.|.....|.|            |:|.|||:::.
  Fly     3 AIQSENY--FVDNYSVSDLMMYPCVELNVEAAPTATTRSSEK------------SKRSRTAFSSL 53

Human   154 QLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGKCKSL- 217
            ||:|||:|||.||||.|.||:||:..|.|||||||:||||||||.|:.|      |.:|...:| 
  Fly    54 QLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKST------NRKGAIGALT 112

Human   218 -------EDSEKVEEDEE--EKTLFEQALSVSGALLER-------EGY---TFQQNALSQQQAPN 263
                   :.||.:::|::  |:.|.....:|..|.|.:       ||.   .:|......:.:| 
  Fly   113 TSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITPPYQSYDYLHEFSP- 176

Human   264 GHNGDSQSFPVSPLTSNEKN-LKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSV 327
                :..:.|..|....:.| ...:....||:|...:.:..|           ..:.|.:|:|..
  Fly   177 ----EPMALPQLPFNEFDANWASSWLGLEPTIPIAENVIEHN-----------TQDQPMIQNFCW 226

Human   328 FSTDSCLQLSDAVSPSLPGSLDSPVDISADSLDF 361
            .|..|....||.        ||...|...:.|:|
  Fly   227 DSNSSSASSSDI--------LDVDYDFIQNLLNF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 2/3 (67%)
Antp-type hexapeptide 94..99 1/4 (25%)
Homeobox 147..200 CDD:395001 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 8/40 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279 3/21 (14%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.