DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA2 and lab

DIOPT Version :10

Sequence 1:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster


Alignment Length:196 Identity:70/196 - (35%)
Similarity:90/196 - (45%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    34 SSSIKT-STLSHSTLIPPPFEQTIPSLNPGS-HP----------RHGAGGRP----KPSPAGSRG 82
            ||||.| ..:.....:|.|....:|:....| |.          |.|.||..    .|...|..|
  Fly   386 SSSIPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNG 450

Human    83 SPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHKESLEIADGSGGG----- 142
            ||...|.|             :.:.:|:.|.:|||..:|       |...:.:..|||.|     
  Fly   451 SPGIGGVL-------------SVQNSLIMANSAAAAGSA-------HPNGMGVGLGSGSGLSSCS 495

Human   143 -----SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQT 202
                 :...||.:||.||.|||||||||:||.|.||:|||..|.|.|.|||:||||||||.|::.
  Fly   496 LSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRV 560

Human   203 Q 203
            :
  Fly   561 K 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 16/65 (25%)
Antp-type hexapeptide 94..99 0/4 (0%)
Homeodomain 144..200 CDD:459649 37/55 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
labNP_476613.1 Homeodomain 505..558 CDD:459649 37/52 (71%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.