DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA2 and lms

DIOPT Version :10

Sequence 1:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_611491.2 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:98 Identity:41/98 - (41%)
Similarity:58/98 - (59%) Gaps:11/98 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   114 AAAATAAATGPACLSH-----KESLEIA--DGSGGG---SRRLRTAYTNTQLLELEKEFHFNKYL 168
            |:.|::.||. :||..     |..:::|  ||:|.|   .:|.|||::..|:..||.||...|||
  Fly    48 ASRASSPATS-SCLDDNMDDGKSDIDLASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYL 111

Human   169 CRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQ 201
            ...:|..:|..|.|||.|:|:||||||.|.||:
  Fly   112 SVAKRTALAKQLQLTETQIKIWFQNRRTKWKRK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93
Antp-type hexapeptide 94..99
Homeodomain 144..200 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
lmsNP_611491.2 Cnd2 33..>106 CDD:450400 20/58 (34%)
Homeodomain 87..143 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.