DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA2 and eve

DIOPT Version :10

Sequence 1:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:147 Identity:50/147 - (34%)
Similarity:60/147 - (40%) Gaps:63/147 - (42%)


- Green bases have known domain annotations that are detailed below.


Human    66 RHGAGGRPKPSP-----------AGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATA 119
            ::|....|.|||           .|||||.:||.                      |:.      
  Fly    34 QYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPAD----------------------PSV------ 70

Human   120 AATGPACLSHKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTE 184
                                    ||.|||:|..||..|||||:...|:.||||.|:||.|:|.|
  Fly    71 ------------------------RRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPE 111

Human   185 RQVKVWFQNRRMKHKRQ 201
            ..:||||||||||.|||
  Fly   112 STIKVWFQNRRMKDKRQ 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 12/37 (32%)
Antp-type hexapeptide 94..99 0/4 (0%)
Homeodomain 144..200 CDD:459649 34/55 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
eveNP_523670.2 Homeodomain 71..127 CDD:459649 34/55 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.