DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA2 and ind

DIOPT Version :10

Sequence 1:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:233 Identity:70/233 - (30%)
Similarity:106/233 - (45%) Gaps:34/233 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    12 INSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIP-PPFEQTIPSLNPGS------HPRHGA 69
            ::|.|.     :.:.|.|..|.|....:...::....| ||.     |.||.|      |..:|:
  Fly    98 VSSSPG-----SLYHPYAQLFASKRKSSGFSNYEGCYPSPPL-----SANPNSQQLPPIHNLYGS 152

Human    70 ---GGRPKPSPAGSRGSPVPAGALQ---PPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLS 128
               ||.|.|.|.....||..:.:..   ...:...:.|:...:::..|.::.....::.||.   
  Fly   153 PVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPV--- 214

Human   129 HKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQN 193
              |...:.:.....|:|:|||:|:|||||||:||..|.||.|.||:|||..|.|:|:|||:||||
  Fly   215 --EITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQN 277

Human   194 RRMKHKR------QTQCKENQNSEGKCKSLEDSEKVEE 225
            ||:|.|:      ......|.|...:...:....||.|
  Fly   278 RRVKQKKGGSESPTFNLSTNSNGSPQASPVSPQVKVHE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 16/63 (25%)
Antp-type hexapeptide 94..99 0/4 (0%)
Homeodomain 144..200 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 6/34 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
indNP_996087.2 Homeodomain 228..284 CDD:459649 36/55 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.