DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2124 and Fastk

DIOPT Version :9

Sequence 1:NP_572638.1 Gene:CG2124 / 31989 FlyBaseID:FBgn0030217 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_075718.2 Gene:Fastk / 66587 MGIID:1913837 Length:545 Species:Mus musculus


Alignment Length:511 Identity:106/511 - (20%)
Similarity:180/511 - (35%) Gaps:114/511 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 RWSSEQLLLVSDAWYRLGLVRIGEYV----------WLALKKLGRKLRKLPPEQLVHSMFLCNLL 214
            ||.|:....|....|.:.|.|:|:.:          ...|:.|.:.:.:..|...||::.:|  |
Mouse    96 RWLSQNPTKVRAHHYPVALRRLGQLLVSQPRPSPVEQATLQDLSQLIIRNCPSFDVHTIHVC--L 158

  Fly   215 RRPVFEMFDFELNLARCVDQMTLSEL--------GVMAMGFFKTQTPIRNPELLTQLYQRLGSEL 271
            ...|...|..:..|...::|...|.|        .....|..:.:..:..|..|....|.|...|
Mouse   159 HLAVLLGFPSDGPLLCALEQERRSRLPPKPPSPHRPAIYGGQRLEVALSCPRFLQYPRQHLIRSL 223

  Fly   272 -----DTVEDIVLVALLKVL-RYSSKLPQ-VEPLKKMLSALESQVDRVSLLTCLHMALLGCELQT 329
                 :.:...|:|.|.:.| |:..:.|| :|.:...|...|:|:                    
Mouse   224 AEARPEELTPHVMVLLAQHLARHRLREPQLLEAIAHFLVVQEAQL-------------------- 268

  Fly   330 CNDALVERILLRFER----ELETARLKDMERICLVMALFNITTKSGVERRLAERLPDLLRQRIEE 390
             |..:|::::|.|.|    .||...:..:|||        :..::||.......:...|      
Mouse   269 -NSKVVQKLVLPFGRLNYMPLEQQFMPCLERI--------LAREAGVAPLATVNILMSL------ 318

  Fly   391 ILRHPRCFSNCLQFLTMRGVYDLELLGVALEPRFLKH--AYPSGLPGREYFH-LDGFARLLGPEY 452
                  |...||.|..::.|:         .|.|:.|  ..|..|..|.|.. ||....|..|.|
Mouse   319 ------CQLQCLPFRALQFVF---------SPSFINHINGTPPSLIVRRYLSLLDTAVELELPGY 368

  Fly   453 QGALVTEKQRQQMGRNYTQ-YIPDRDGRFKLNNTDRILVEIRDAI--TMIHRPVTFKHILPQYDR 514
            ||..:.::||..:   :.| .|.|| .|.|.::.|.:...:|..:  ....:.:|   :.|.|  
Mouse   369 QGPRLPQRQRVPI---FPQPLITDR-ARCKYSHKDMVAEGLRQLLGEENYRQNLT---VPPGY-- 424

  Fly   515 C-DVVLCYD--------RRQRKALSINGEACQDYSGEILTRKHLLGERKAADDQLVTVVIVIAGW 570
            | |.:||..        |.|...|.....:||......         .....|....||:::...
Mouse   425 CTDFLLCVSSSGAVLPMRTQDPFLPYPPRSCQQDQANF---------NSTTQDPAQRVVLMLRER 480

  Fly   571 NNVIRDKDRFTGQMDMKLRQLRQLGHQPLVIYWHEWRELENSADRQDFLKRRLSQI 626
            .:..||.....|...::.|.|..:|:|.|.:.:.|..........:.:|:::|..:
Mouse   481 WHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQAL 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2124NP_572638.1 RAP 565..622 CDD:214932 10/56 (18%)
FastkNP_075718.2 FAST_1 274..339 CDD:284217 18/93 (19%)
FAST_2 354..439 CDD:285557 24/93 (26%)
RAP 480..532 CDD:214932 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.