DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2124 and fastkd2

DIOPT Version :9

Sequence 1:NP_572638.1 Gene:CG2124 / 31989 FlyBaseID:FBgn0030217 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_021331610.1 Gene:fastkd2 / 564382 ZFINID:ZDB-GENE-090313-7 Length:652 Species:Danio rerio


Alignment Length:589 Identity:116/589 - (19%)
Similarity:210/589 - (35%) Gaps:172/589 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EQLHRLTDEQLLGSLSALAELPVPESPKAKNYMEIWNTLDIECCRRIERWSSEQLLLVSDAWYRL 176
            |...::|.||....|..:.|.|        .:.|:        |.|:          |||||   
Zfish   127 ESTKKMTAEQQRCELQLMFEHP--------GFREV--------CERV----------VSDAW--- 162

  Fly   177 GLVRIGE--YVWLALKKLGRKLRKLPPEQLVHSMFLCNLLRRPVFEMFDFELN----LARCVDQM 235
             .:|..:  |..||:..||..         .|:..:..|||.....:..|:..    ||..:.||
Zfish   163 -RMRCDDLAYTLLAIINLGVS---------QHTRIVQTLLRVVQERLNQFDNRSLSVLAAGIQQM 217

  Fly   236 -------TLSE-LGVMAMGFFKTQTP-IRNPELLTQLYQRLGSELDTVEDIVLVALLKVLRYSSK 291
                   .|.| ||::    .|.:.| |.|..:|..:.:.:|.  ::.:::.:...:|.|..:.:
Zfish   218 ENGNNVQALREALGLL----LKDRVPEISNVVVLQNMMRAMGK--NSPKELKMQLAIKTLSLADE 276

  Fly   292 L--PQVEPLKKMLSALESQVDRVSLLTC---------------LHMALLGC-ELQTCNDALVERI 338
            .  |..:.:...|:|::... :..|..|               |.|.|..| |||..|.:|...|
Zfish   277 FSPPNTQYVFLSLAAMDLNF-KPLLNICSKNIAENVHEFPISRLVMVLKSCYELQYRNYSLFSSI 340

  Fly   339 LLRFERELETARLKDMERICLVMALFN------ITTKSGVERRLAERLPDLLRQRIEEILRHPRC 397
               .|....|..:...:::.|::..|.      :........|:.:: ||.|  .::::|...:.
Zfish   341 ---SEYMTNTFDMWSNKKVILLLLTFEDLYFRPVHLLDAFAERIIQK-PDSL--TLKDLLSVLKV 399

  Fly   398 FSNCLQFLTMRGVYDLELLGVALEPRFLKHAYPSGLPGREYFHLDGFARLLGPEYQGALVTEKQR 462
            ||.....|..|....|:.:...|| .:|....||.|....|:       |...|:...::.:|..
Zfish   400 FSMLNHDLKERKTEFLDCITEVLE-SYLPKMTPSELLKVNYY-------LALMEHFHQMLLDKLM 456

  Fly   463 QQMGRNYTQYIPDRDGRFKLNNTDRILVEIRDAITMIHRPVTFKHILPQYDRCDVVLCYDRRQ-- 525
            ||            :...:|..||:..:::   :..:|             ..|:.|..|:.|  
Zfish   457 QQ------------ETLEQLLQTDKPSIKV---LRWLH-------------TIDLCLQLDKPQLP 493

  Fly   526 ----RKALSINGEACQDYSG-EILTR-KHLLGERKAAD----------DQLVT------------ 562
                .|.|:|...|.:..:. |:|:. :.::|.....|          |.::|            
Zfish   494 SFTSSKPLNITVPAFEATANQEMLSAVRSIVGTHAVQDSVLEQSIYFIDCVITLPGEKVETCGLH 558

  Fly   563 -----------VVIVIAGWNNVIRDKDRFTGQMDMKLRQLRQLGHQPLVIYWHEWRELENSADRQ 616
                       :.::.|..|:...........:.||||.|.:||:||:::..:|.    ||...:
Zfish   559 EDCGSPECNQRIAVICAQPNSFCFGTTHPRASLVMKLRHLEKLGYQPVLVPINEL----NSKTEE 619

  Fly   617 DFLK 620
            :.:|
Zfish   620 EKIK 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2124NP_572638.1 RAP 565..622 CDD:214932 15/56 (27%)
fastkd2XP_021331610.1 FAST_1 394..463 CDD:310980 18/88 (20%)
RAP 577..628 CDD:214932 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.