DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2124 and Fastk

DIOPT Version :9

Sequence 1:NP_572638.1 Gene:CG2124 / 31989 FlyBaseID:FBgn0030217 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001358218.1 Gene:Fastk / 296741 RGDID:1311601 Length:545 Species:Rattus norvegicus


Alignment Length:525 Identity:106/525 - (20%)
Similarity:179/525 - (34%) Gaps:142/525 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 RWSSEQLLLVSDAWYRLGLVRIGEYV----------WLALKKLGRKLRKLPPEQLVHSMFLCNLL 214
            ||.|:....|....|.:.|.|:|:.:          ...|:.|.:.:.:..|...||::.:|  |
  Rat    96 RWLSQNPTKVRAHHYPVALRRLGQLLVSQPRPSPVEQATLQDLSQLIIRNCPSFDVHTIHVC--L 158

  Fly   215 RRPVFEMFDFELNLARCVDQMTLSELGVMAMGFFKTQTPIRNPELLTQLY--QRLGSELDTVEDI 277
            ...|...|..:..|...::|...|.:..      |..:| |.|    .:|  |||.:.|      
  Rat   159 HLAVLLGFPSDGPLLCALEQERRSRVPP------KPPSP-RQP----AIYGGQRLEAAL------ 206

  Fly   278 VLVALLKVLRYSSKLPQVEPLKKMLSAL-ESQVDRVSLLTCLHMA----------------LLGC 325
               :..:.|||    |:...::.:..|. |.....|.:|...|:|                |:..
  Rat   207 ---SCPRFLRY----PRQHLIRSLAEARPEELTPHVMVLLAQHLARHRLREPQLLEAIAHFLVVQ 264

  Fly   326 ELQTCNDALVERILLRFER----ELETARLKDMERICLVMALFNITTKSGVERRLAERLPDLLRQ 386
            |.| .|..:|::::|.|.|    .||...:..:|||        :..::||.             
  Rat   265 EAQ-LNSKVVQKLVLPFGRLNYLPLEQQFMPCLERI--------LAREAGVA------------- 307

  Fly   387 RIEEILRHPRCFSNCLQFLTMRGVYDLELLGVALEPRFLKH--AYPSGLPGREYFH-LDGFARLL 448
                    |....|.|..|..........|.....|.|:.|  ..|..|..|.|.. ||....|.
  Rat   308 --------PLATVNILMSLCQLQRLPFRALQFVFSPSFISHINGTPPSLIVRRYLSLLDTAVELE 364

  Fly   449 GPEYQGALVTEKQRQQMGRNYTQ-YIPDRDGRFKLNNTDRILVEIRDAITMIHRPVTFKHILPQY 512
            .|.|:|..:.::||..:   :.| .|.|| .|.|.::.|.:...:|.                  
  Rat   365 LPGYRGPRLPQRQRVPI---FPQPLITDR-ARCKYSHKDMVAEGLRQ------------------ 407

  Fly   513 DRCDVVLCYDRRQRKALSINGEACQDY------SGEIL---TRKHLL------------GERKAA 556
                  |..:.:.|:.|::....|.|:      ||.:|   |:...|            ......
  Rat   408 ------LLGEEKYRQDLTVPPGYCTDFLLCVGGSGAVLPMRTQDPFLPYPPRPCQQDQANSNSTT 466

  Fly   557 DDQLVTVVIVIAGWNNVIRDKDRFTGQMDMKLRQLRQLGHQPLVIYWHEWRELENSADRQDFLKR 621
            .|....||:::....:..||.....|...::.|.|..:|:|.|.:.:.|..........:.:|::
  Rat   467 QDPTQRVVLMLRERWHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQ 531

  Fly   622 RLSQI 626
            :|..:
  Rat   532 KLQAL 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2124NP_572638.1 RAP 565..622 CDD:214932 10/56 (18%)
FastkNP_001358218.1 FAST_1 274..339 CDD:399608 17/93 (18%)
FAST_2 352..439 CDD:400599 24/114 (21%)
RAP 480..532 CDD:214932 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21228
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.