DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2124 and FASTK

DIOPT Version :9

Sequence 1:NP_572638.1 Gene:CG2124 / 31989 FlyBaseID:FBgn0030217 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_006703.1 Gene:FASTK / 10922 HGNCID:24676 Length:549 Species:Homo sapiens


Alignment Length:596 Identity:120/596 - (20%)
Similarity:196/596 - (32%) Gaps:199/596 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LSALAELPVPESPKAKNYMEIWNTLDIECCRRIERWSSEQLLLVSDAWYRLGLVRI-------GE 183
            ||.|..:| |..|               ||....:|....:.....|....||.|:       ||
Human    49 LSGLLLIP-PVQP---------------CCLGPSKWGDRPVGGGPSAGPVQGLQRLLEQAKSPGE 97

  Fly   184 YV-WL--------------ALKKLGRKL--RKLPPEQLVHSMFLCNLLRRPVFEMFDFELNLARC 231
            .: ||              ||::||:.|  |..||.                             
Human    98 LLRWLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPP----------------------------- 133

  Fly   232 VDQMTLSELGVMAMGFFKTQTPIRN-PELLTQLYQRLGSELDTVEDIVLVALL------------ 283
            |:|:||.:|         :|..||| |..          ::.|:...:.:|:|            
Human   134 VEQVTLQDL---------SQLIIRNCPSF----------DIHTIHVCLHLAVLLGFPSDGPLVCA 179

  Fly   284 ----KVLRYSSK-LPQVEPLKKMLSALESQVDRVSLLTCLHMALLGCELQTCNDALVERILLRFE 343
                :.||...| .|.::||.:....||:.:.....|......|:....:...:.|...:::...
Human   180 LEQERRLRLPPKPPPPLQPLLRGGQGLEAALSCPRFLRYPRQHLISSLAEARPEELTPHVMVLLA 244

  Fly   344 RELETARLKD---MERICLVMALFNITTKSGVERRLA------ERLPDLLRQR----IEEILRHP 395
            :.|...||::   :|.|...:.:......|.|.::|.      ..||  |.|:    :|.||...
Human   245 QHLARHRLREPQLLEAIAHFLVVQETQLSSKVVQKLVLPFGRLNYLP--LEQQFMPCLERILARE 307

  Fly   396 R--------------CFSNCLQFLTMRGVYDLELLGVALEPRFLKHAYPSGLPG----REYFH-L 441
            .              |...||.|..:..|:         .|.|:.  |.||.|.    |.|.. |
Human   308 AGVAPLATVNILMSLCQLRCLPFRALHFVF---------SPGFIN--YISGTPHALIVRRYLSLL 361

  Fly   442 DGFARLLGPEYQGALVTEKQRQQMGRNYTQYIPDRDGRFKLNNTDRILVEIRDAITMIHRPVTFK 506
            |....|..|.|:|..:  .:|||:.......|.|| .|.|.::.|.:...:|.            
Human   362 DTAVELELPGYRGPRL--PRRQQVPIFPQPLITDR-ARCKYSHKDIVAEGLRQ------------ 411

  Fly   507 HILPQYDRCDVVLCYDRRQRKALSINGEACQDY------SGEIL---TRKHLL-------GERKA 555
                        |..:.:.|:.|::....|.|:      ||.:|   |:...|       .:.:|
Human   412 ------------LLGEEKYRQDLTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCPQGQA 464

  Fly   556 AD-----DQLVTVVIVIAGWNNVIRDKDRFTGQMDMKLRQLRQLGHQPLVIYWHEWRELENSADR 615
            |.     |....||:|:....:..||.....|...::.|.|..:|:|.|.:.:.|..........
Human   465 ASSATTRDPAQRVVLVLRERWHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQL 529

  Fly   616 QDFLKRRLSQI 626
            :.:|:::|..:
Human   530 KSYLRQKLQAL 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2124NP_572638.1 RAP 565..622 CDD:214932 11/56 (20%)
FASTKNP_006703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
FAST_1 278..343 CDD:310980 15/75 (20%)
FAST_2 358..443 CDD:312018 23/111 (21%)
RAP 484..536 CDD:214932 10/51 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.