DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmr and LOC100330838

DIOPT Version :9

Sequence 1:NP_572637.2 Gene:Hmr / 31988 FlyBaseID:FBgn0001206 Length:1413 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:129 Identity:36/129 - (27%)
Similarity:58/129 - (44%) Gaps:21/129 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ERLLIALVRRQPLLYDARHPKFRDVAQREKQWKKIASRLATNATNCKRSWSALR---YKYQRHVR 117
            |..|||.|...|.||::....::|.|::.|.|:.::.::.....:|:|.|.:||   .|.:|..:
Zfish     6 EERLIAAVSDYPELYNSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKDKRAEQ 70

  Fly   118 RLR---NFHRSAIQKDRAALRWRPCMEYEEEMRFMYTHVARFPLIVDKIPTEILEKEHVDESET 178
            |.|   ..|||          |:    |..:|.|:...:....|..|: |.|..:.|..||..|
Zfish    71 RRRASGTSHRS----------WK----YSWQMSFLTPFIQSRSLAADE-PEEDRDDEDKDEERT 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmrNP_572637.2 MADF_DNA_bdg 59..149 CDD:287510 26/95 (27%)
GT1 213..295 CDD:304916
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 27/101 (27%)
BESS 167..200 CDD:397204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.