DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spri and VPS9B

DIOPT Version :9

Sequence 1:NP_001259418.1 Gene:spri / 31987 FlyBaseID:FBgn0085443 Length:2043 Species:Drosophila melanogaster
Sequence 2:NP_196494.2 Gene:VPS9B / 830791 AraportID:AT5G09320 Length:437 Species:Arabidopsis thaliana


Alignment Length:308 Identity:67/308 - (21%)
Similarity:116/308 - (37%) Gaps:87/308 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1695 IENFICCTKESREAAPQVVMRNMRQFMSGMKNYLVK------------HGEGKFHAELETA-RAR 1746
            :.||:     |:.:|        :.|:..:|:::|.            .....|..::|:| ||.
plant    10 LHNFL-----SKPSA--------KDFIKSIKSFIVSILNTAPDPEKDCDAVQDFFYKMESAFRAH 61

  Fly  1747 -----LKSDEFLNL-DAMLETVMHQLVVLPLREHLYGIFVDH--YQRSEDIQLLAQNVRYACERE 1803
                 ...||..|. |.:.:.||.:|.......:...:..|.  :|:   |.|:.|.:      .
plant    62 PLWSGCSDDELDNAGDGLEKYVMTKLFPRVFASNTEDVISDEKLFQK---ISLVQQFI------S 117

  Fly  1804 AADFGIRPTVTPPSQAALRLIANLLWRLQEAELPLDKLELFLCVI-------STVFDATGCPRGQ 1861
            ..:..|:||.  .:|.:..|....|.::.....|.|||   :|::       :.:.:|:......
plant   118 PENLDIQPTF--QNQTSWLLAQKELQKINMYNAPRDKL---MCILRCCKVINNLLLNASIASNQN 177

  Fly  1862 QLGADDFLPVLVYVVAKCGFVGAEIEAEFMWGLL------QPTLLNGEPGYYLTALCSAVQVL-- 1918
            :.|||.|||||:||..|..      ..:|...||      :.:.|.||.||..|.:.||...:  
plant   178 EPGADQFLPVLIYVTIKAN------PPQFHSNLLYIQRYRRQSKLVGEAGYLFTNILSAESFISN 236

  Fly  1919 ---KTFMASEGE------------SGSGSLDWRS---SCLPACSSVLR 1948
               |:....|.:            ||.||..:::   :.||...:..|
plant   237 IDAKSLSMDEADFETKMKSAHARLSGPGSQSYQTDHGAALPTAHNTKR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spriNP_001259418.1 SH2 716..813 CDD:301589
VPS9 1821..1922 CDD:280383 31/118 (26%)
UBQ 1946..2026 CDD:294102 1/3 (33%)
VPS9BNP_196494.2 DUF5601 24..88 CDD:407982 13/63 (21%)
VPS9 133..238 CDD:366977 30/113 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23101
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.