DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spri and VPS9A

DIOPT Version :9

Sequence 1:NP_001259418.1 Gene:spri / 31987 FlyBaseID:FBgn0085443 Length:2043 Species:Drosophila melanogaster
Sequence 2:NP_566645.1 Gene:VPS9A / 821514 AraportID:AT3G19770 Length:520 Species:Arabidopsis thaliana


Alignment Length:274 Identity:62/274 - (22%)
Similarity:111/274 - (40%) Gaps:59/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1681 LQLAQDPSS-TFARNIENFICCTKESREAAPQVVMRNMRQFMSGMKNYLVKH--GEGKFHAELET 1742
            |:..:.||: .|.::|::|| .:..:....|:.....:::|.|.|:.....|  ..|....||::
plant    14 LERMRKPSAGDFVKSIKSFI-VSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDS 77

  Fly  1743 ARARLKSDEFLNLDAMLETVMHQLVVLPLREHLYGIFVDH--YQRSEDIQLLAQNVRYACEREAA 1805
            |.           |.:.:.||.:|.......:...:..|.  :|:   :.|:.|.:      ...
plant    78 AG-----------DGLEKYVMTKLFTRVFASNTEEVIADEKLFQK---MSLVQQFI------SPE 122

  Fly  1806 DFGIRPTVTPPSQAALRLIANLLWRLQEAEL--------PLDKLELFLCVI-------STVFDAT 1855
            :..|:||....|.          |.|.:.||        |.|||   :|::       :.:.:|:
plant   123 NLDIQPTFQNESS----------WLLAQKELQKINMYKAPRDKL---VCILNCCKVINNLLLNAS 174

  Fly  1856 GCPRGQQLGADDFLPVLVYVVAKCGFVGAEIEAEFMWGLLQPTLLNGEPGYYLTALCSAVQVLKT 1920
            ........|||:|||||:||..|...........::....:.:.|.||..|:.|.:.||    ::
plant   175 IASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSA----ES 235

  Fly  1921 FMASEGESGSGSLD 1934
            |: |..::.|.|||
plant   236 FI-SNIDAKSISLD 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spriNP_001259418.1 SH2 716..813 CDD:301589
VPS9 1821..1922 CDD:280383 28/115 (24%)
UBQ 1946..2026 CDD:294102
VPS9ANP_566645.1 DUF5601 27..91 CDD:407982 15/75 (20%)
VPS9 136..241 CDD:366977 30/112 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23101
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.