DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spri and VPS9A

DIOPT Version :10

Sequence 1:NP_001259418.1 Gene:spri / 31987 FlyBaseID:FBgn0085443 Length:2043 Species:Drosophila melanogaster
Sequence 2:NP_566645.1 Gene:VPS9A / 821514 AraportID:AT3G19770 Length:520 Species:Arabidopsis thaliana


Alignment Length:274 Identity:62/274 - (22%)
Similarity:111/274 - (40%) Gaps:59/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1681 LQLAQDPSS-TFARNIENFICCTKESREAAPQVVMRNMRQFMSGMKNYLVKH--GEGKFHAELET 1742
            |:..:.||: .|.::|::|| .:..:....|:.....:::|.|.|:.....|  ..|....||::
plant    14 LERMRKPSAGDFVKSIKSFI-VSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDS 77

  Fly  1743 ARARLKSDEFLNLDAMLETVMHQLVVLPLREHLYGIFVDH--YQRSEDIQLLAQNVRYACEREAA 1805
            |.           |.:.:.||.:|.......:...:..|.  :|:   :.|:.|.:      ...
plant    78 AG-----------DGLEKYVMTKLFTRVFASNTEEVIADEKLFQK---MSLVQQFI------SPE 122

  Fly  1806 DFGIRPTVTPPSQAALRLIANLLWRLQEAEL--------PLDKLELFLCVI-------STVFDAT 1855
            :..|:||....|.          |.|.:.||        |.|||   :|::       :.:.:|:
plant   123 NLDIQPTFQNESS----------WLLAQKELQKINMYKAPRDKL---VCILNCCKVINNLLLNAS 174

  Fly  1856 GCPRGQQLGADDFLPVLVYVVAKCGFVGAEIEAEFMWGLLQPTLLNGEPGYYLTALCSAVQVLKT 1920
            ........|||:|||||:||..|...........::....:.:.|.||..|:.|.:.||    ::
plant   175 IASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSA----ES 235

  Fly  1921 FMASEGESGSGSLD 1934
            |: |..::.|.|||
plant   236 FI-SNIDAKSISLD 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spriNP_001259418.1 SH2 716..813 CDD:472789
VPS9 1824..1922 CDD:460489 28/112 (25%)
RA_Rin 1946..2030 CDD:340474
VPS9ANP_566645.1 DUF5601 27..91 CDD:465668 15/75 (20%)
VPS9 136..241 CDD:460489 30/112 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.