DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spri and Rabex-5

DIOPT Version :9

Sequence 1:NP_001259418.1 Gene:spri / 31987 FlyBaseID:FBgn0085443 Length:2043 Species:Drosophila melanogaster
Sequence 2:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster


Alignment Length:422 Identity:91/422 - (21%)
Similarity:150/422 - (35%) Gaps:132/422 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1643 VATILRNPSMR--DREVLCH--------PRN-------------------KMSIQSSGPGDSLRA 1678
            ::|..|.||:|  .:::.|.        |:|                   |.:...:|||.|...
  Fly     1 MSTAARPPSLRLGQQDLKCRSGCGFYGTPQNEGLCSMCFREKFNDKQRKLKQTGGETGPGSSSSV 65

  Fly  1679 YTL---------------QLAQDPSSTFARNIENFICCTKESREAAPQVVMRNMRQFMSGMKNYL 1728
            .||               |..:.||.   :..:|.....|:...|..|..::...|.::..:.::
  Fly    66 ATLDRRSPQHAHLQGKVEQQVRKPSD---KEQDNLGTLQKKKFTAVLQKTLQAGAQKITQQRGHV 127

  Fly  1729 VKHGEGKFHAELETAR-------------ARLKSD--EFLN---------LDAMLE---TVMHQL 1766
            ....||:|..:|...|             .||.||  :::|         |..:::   |.:..:
  Fly   128 PDPTEGQFLLQLRQLRIPDDGKRKLKLEIQRLDSDIRKYMNGNGGKNINELSDLVQNAYTKVSDI 192

  Fly  1767 V-----------------------VLPLREHLYGIFVDHYQRSEDIQLLAQ-NVRYACEREAADF 1807
            |                       |:..:.|.: :|..::...||..:..| .:|......|...
  Fly   193 VHNDPSFEIATNEDRDSAIDFFEKVVMTQNHKF-LFSPYFTTDEDSDVKVQKRIRQLSWITAKHL 256

  Fly  1808 GIRPTVTPPSQAALRLIANLLWRLQEAE---LPLDKLELFLCVISTVFD----ATGCPRGQQLGA 1865
            ..  ::...:..|..|:.|.:..|...:   .|.:||:........:|:    |||.|    ..|
  Fly   257 DC--SIDEVNSEARDLVYNAISELVGIDSYYSPQEKLQCTWRCCRHIFELLKRATGGP----ASA 315

  Fly  1866 DDFLPVLVYVVAKCGFVGAEIEAEFMWGLLQPT-LLNGEPGYYLTALCSAVQVLKTFMASEGES- 1928
            |||||.|::||.|...|.......|:......: |::||.|||.|.||||:..::..   .||| 
  Fly   316 DDFLPALIFVVLKANPVRLHSNINFVTRFTNASRLMSGESGYYFTNLCSAIAFIENL---NGESL 377

  Fly  1929 ----------GSG----SLDWRSSCLPACSSV 1946
                      .||    |..|.|:.| ||.|:
  Fly   378 GVSSEEFEALMSGQQPYSTPWESALL-ACESL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spriNP_001259418.1 SH2 716..813 CDD:301589
VPS9 1821..1922 CDD:280383 34/108 (31%)
UBQ 1946..2026 CDD:294102 0/1 (0%)
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010 3/22 (14%)
VPS9 274..373 CDD:280383 32/105 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23101
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.