DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spri and vps902

DIOPT Version :9

Sequence 1:NP_001259418.1 Gene:spri / 31987 FlyBaseID:FBgn0085443 Length:2043 Species:Drosophila melanogaster
Sequence 2:NP_001342780.1 Gene:vps902 / 2540384 PomBaseID:SPBC29A10.11c Length:402 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:32/136 - (23%)
Similarity:56/136 - (41%) Gaps:40/136 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1821 LRLIANLLWRLQEAELPLDKLELFLCVISTVFDATGCPRGQQLGADDFLPVLVY---------VV 1876
            |..::...:.|.|...|..|:..|:.|.|::.:|:..|: ::|.||..|.:.:|         ::
pombe   173 LHEVSEAFFALDEQHTPRSKINTFMTVNSSILNASQLPQ-EELNADSLLNLTIYCILCYPGFHLI 236

  Fly  1877 AKCGFVGAEIEAEFMWGLLQPTLLNGEPGYYLTALCSAVQVLKTFMASEGESGSGSLDWRSSCLP 1941
            :...||.....|:|         |:||..|.||...:|:    ||:                 |.
pombe   237 SHLNFVLRFRNADF---------LSGEQRYCLTTFEAAL----TFI-----------------LR 271

  Fly  1942 ACSSVL 1947
            ||.::|
pombe   272 ACPNLL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spriNP_001259418.1 SH2 716..813 CDD:301589
VPS9 1821..1922 CDD:280383 27/109 (25%)
UBQ 1946..2026 CDD:294102 1/2 (50%)
vps902NP_001342780.1 VPS9 173..274 CDD:308039 30/131 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23101
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.