powered by:
Protein Alignment CG15296 and Micos13
DIOPT Version :9
Sequence 1: | NP_001259422.1 |
Gene: | CG15296 / 31986 |
FlyBaseID: | FBgn0030215 |
Length: | 169 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038939069.1 |
Gene: | Micos13 / 301124 |
RGDID: | 1588578 |
Length: | 137 |
Species: | Rattus norvegicus |
Alignment Length: | 39 |
Identity: | 11/39 - (28%) |
Similarity: | 18/39 - (46%) |
Gaps: | 5/39 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 NIPNYSEELADG--AKVTCLDLV-EKAKELRHK--EYSK 116
|.||:.:....| :.:..|.:. .||:|...: ||.|
Rat 95 NFPNFRDSWNSGIISVMAALSVAPSKAREYSREGWEYVK 133
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15296 | NP_001259422.1 |
QIL1 |
5..93 |
CDD:292509 |
3/9 (33%) |
Micos13 | XP_038939069.1 |
QIL1 |
43..124 |
CDD:406340 |
7/28 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1599526at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.