DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15296 and Micos13

DIOPT Version :9

Sequence 1:NP_001259422.1 Gene:CG15296 / 31986 FlyBaseID:FBgn0030215 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_038939069.1 Gene:Micos13 / 301124 RGDID:1588578 Length:137 Species:Rattus norvegicus


Alignment Length:39 Identity:11/39 - (28%)
Similarity:18/39 - (46%) Gaps:5/39 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NIPNYSEELADG--AKVTCLDLV-EKAKELRHK--EYSK 116
            |.||:.:....|  :.:..|.:. .||:|...:  ||.|
  Rat    95 NFPNFRDSWNSGIISVMAALSVAPSKAREYSREGWEYVK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15296NP_001259422.1 QIL1 5..93 CDD:292509 3/9 (33%)
Micos13XP_038939069.1 QIL1 43..124 CDD:406340 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1599526at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.