DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32687 and f-cup

DIOPT Version :9

Sequence 1:NP_001259412.1 Gene:CG32687 / 31980 FlyBaseID:FBgn0052687 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001262544.1 Gene:f-cup / 41677 FlyBaseID:FBgn0028487 Length:802 Species:Drosophila melanogaster


Alignment Length:324 Identity:83/324 - (25%)
Similarity:142/324 - (43%) Gaps:70/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VYTSDSSDTDSR----EQKT---------------LDFGR-------------MSLDLVTLEDHL 35
            :|..:.:|.||:    ||.|               ||...             .||.::||.|: 
  Fly   126 LYDINEADADSKAVNLEQLTIKEEDAWWNQVPLNNLDLSSNTLTHISPKIENLQSLTVLTLHDN- 189

  Fly    36 ASPQKALLK---SSGDIETML---LNHNRLVGLPRLLLQFGNLKILDLSSNAITTLPDAVCQLPL 94
                 ||::   ..|.:|.::   ::||:|..|||.:.....|:.|::|.|....|...:..|.:
  Fly   190 -----ALVELPPEIGKLEKLVRLNVSHNKLSQLPRAMYSLPELRHLNISYNEFVELNPDISDLHM 249

  Fly    95 VTLI--AKNNLLTNASLPKSLLTKMANGNGNGNATGGTNSTLKELNLSGNQLTHFPEQVTELRHL 157
            :..:  ..||:   .|||..:               |....|..|.|..|.:...|..:..:|.|
  Fly   250 LEFLDGGHNNI---QSLPGGI---------------GFLVRLTALLLPYNHIKELPPDLVNMRSL 296

  Fly   158 KYLYLGGNKISSVSKDIWKMQSLHVLSLGGNLISEVPEAVG--SLNQLQALVLCDNLIEILPTSI 220
            :.:.|..|.::|:.:|:..::.|..|.|..|.|.|:||..|  :||:|.|   .:|.|:|:|.::
  Fly   297 QKIDLMHNDLTSLPEDMGLLRKLDCLYLQHNDILELPEFEGNEALNELHA---SNNFIKIIPKAM 358

  Fly   221 -ARLKNLKSLLLHKNRLRHLPKDIVALKNLTELSLRDNPLVVRFVQDMALKPPTLLELAGRMVK 283
             :.|.:||.|.|..|::..||.::..|:||..|.:.:|.:.|..|...:|.....|::.|..:|
  Fly   359 CSNLPHLKILDLRDNKITELPDELCLLRNLNRLDVSNNTISVLPVTLSSLAHLISLQVEGNPIK 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32687NP_001259412.1 leucine-rich repeat 72..92 CDD:275380 5/19 (26%)
leucine-rich repeat 94..133 CDD:275380 6/40 (15%)
LRR_8 132..190 CDD:290566 15/57 (26%)
LRR_4 134..171 CDD:289563 10/36 (28%)
leucine-rich repeat 134..156 CDD:275380 5/21 (24%)
leucine-rich repeat 157..179 CDD:275380 5/21 (24%)
leucine-rich repeat 180..202 CDD:275380 10/23 (43%)
LRR_8 202..259 CDD:290566 19/57 (33%)
leucine-rich repeat 203..225 CDD:275380 7/22 (32%)
leucine-rich repeat 226..248 CDD:275380 8/21 (38%)
f-cupNP_001262544.1 leucine-rich repeat 111..140 CDD:275380 4/13 (31%)
LRR_RI 155..>377 CDD:238064 63/248 (25%)
leucine-rich repeat 158..180 CDD:275380 2/21 (10%)
LRR_8 180..235 CDD:290566 18/60 (30%)
leucine-rich repeat 181..203 CDD:275380 7/27 (26%)
leucine-rich repeat 204..226 CDD:275380 6/21 (29%)
LRR_8 225..283 CDD:290566 16/75 (21%)
leucine-rich repeat 227..249 CDD:275380 6/21 (29%)
leucine-rich repeat 250..272 CDD:275380 6/39 (15%)
LRR_8 272..329 CDD:290566 15/56 (27%)
leucine-rich repeat 273..295 CDD:275380 5/21 (24%)
leucine-rich repeat 296..318 CDD:275380 5/21 (24%)
LRR_8 317..375 CDD:290566 23/60 (38%)
leucine-rich repeat 319..340 CDD:275380 9/20 (45%)
leucine-rich repeat 341..364 CDD:275380 9/25 (36%)
leucine-rich repeat 389..410 CDD:275380 5/20 (25%)
leucine-rich repeat 411..430 CDD:275380 3/12 (25%)
leucine-rich repeat 627..650 CDD:275380
leucine-rich repeat 651..669 CDD:275380
leucine-rich repeat 697..719 CDD:275380
LRR_8 719..777 CDD:290566
leucine-rich repeat 720..743 CDD:275380
leucine-rich repeat 744..766 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45752
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.