DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32687 and CG3494

DIOPT Version :9

Sequence 1:NP_001259412.1 Gene:CG32687 / 31980 FlyBaseID:FBgn0052687 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_611915.1 Gene:CG3494 / 37903 FlyBaseID:FBgn0035008 Length:240 Species:Drosophila melanogaster


Alignment Length:258 Identity:64/258 - (24%)
Similarity:98/258 - (37%) Gaps:81/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NLKILDLSSNAITTLPDAV---CQLPLVTLIAKNNLLTNASLPKSLLTKMANGNGNGNATGGTNS 132
            |.:||.:|...|:.:|..|   .|..||.::                                  
  Fly    36 NTRILQVSKAQISEVPMEVFEAAQQELVNIV---------------------------------- 66

  Fly   133 TLKELNLSGNQLTHFPEQVTEL-RHLKYLYLGGNKISSVSKDIWKMQSLHVLSLGGNLISEVPEA 196
                 :|.||:|...|:.:..| .||..|.|..|:||.|..:|.:...|..|||..||:.::|..
  Fly    67 -----SLDGNRLLEMPKDLPLLSEHLTQLVLNKNQISFVPTNISQYSKLTNLSLSNNLLCDLPME 126

  Fly   197 VGSLNQLQALVLCDNLIEILPTSIARLKNLKSLLLHKNRLRHL---PKDIVALKNLTELSLRDNP 258
            :|.|..|:.|.:..|....||..|..|:.|::|..|.|::|.:   ...:..::.|..|:|.:| 
  Fly   127 LGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQIRAIDASESGLGGMRELKRLNLGNN- 190

  Fly   259 LVVRFVQDMALKPPTL--------LELAGRMVKASGQRPGPYDIPR---------TLAEYLNS 304
                   |:.:.||.|        |||.|          .|:..||         .|..||.:
  Fly   191 -------DIQIVPPILGKMQNLVELELWG----------NPFRQPRHQILSMGTPALLSYLRT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32687NP_001259412.1 leucine-rich repeat 72..92 CDD:275380 6/22 (27%)
leucine-rich repeat 94..133 CDD:275380 2/38 (5%)
LRR_8 132..190 CDD:290566 20/58 (34%)
LRR_4 134..171 CDD:289563 13/37 (35%)
leucine-rich repeat 134..156 CDD:275380 6/22 (27%)
leucine-rich repeat 157..179 CDD:275380 8/21 (38%)
leucine-rich repeat 180..202 CDD:275380 9/21 (43%)
LRR_8 202..259 CDD:290566 16/59 (27%)
leucine-rich repeat 203..225 CDD:275380 7/21 (33%)
leucine-rich repeat 226..248 CDD:275380 5/24 (21%)
CG3494NP_611915.1 LRR <34..>231 CDD:227223 61/251 (24%)
leucine-rich repeat 38..62 CDD:275380 7/23 (30%)
leucine-rich repeat 63..86 CDD:275380 7/61 (11%)
LRR_4 85..124 CDD:289563 15/38 (39%)
leucine-rich repeat 87..109 CDD:275380 8/21 (38%)
leucine-rich repeat 110..133 CDD:275380 9/22 (41%)
leucine-rich repeat 134..155 CDD:275380 6/20 (30%)
leucine-rich repeat 156..181 CDD:275380 5/24 (21%)
leucine-rich repeat 182..204 CDD:275380 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.