Sequence 1: | NP_001259412.1 | Gene: | CG32687 / 31980 | FlyBaseID: | FBgn0052687 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286627.1 | Gene: | CG11099 / 37282 | FlyBaseID: | FBgn0034485 | Length: | 378 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 54/198 - (27%) |
---|---|---|---|
Similarity: | 95/198 - (47%) | Gaps: | 18/198 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 LKELNLSGNQLTHFPEQVTELRHLKYLYLGGNKISSVSKDIWKMQSLHVLSLGGNLISEVPEAVG 198
Fly 199 SLNQLQALVLCDNLIEILPTSIARLKNLKSLLLHKNRLRHLPKDIVALKNLTELSLRDNPLVVRF 263
Fly 264 VQDMALKPPTLLELAGRMVKASGQRPGPYDIPRTLAEYLNSANCCVNPNCKGV----------FF 318
Fly 319 DNR 321 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32687 | NP_001259412.1 | leucine-rich repeat | 72..92 | CDD:275380 | |
leucine-rich repeat | 94..133 | CDD:275380 | |||
LRR_8 | 132..190 | CDD:290566 | 16/55 (29%) | ||
LRR_4 | 134..171 | CDD:289563 | 11/36 (31%) | ||
leucine-rich repeat | 134..156 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 157..179 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 180..202 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 202..259 | CDD:290566 | 20/56 (36%) | ||
leucine-rich repeat | 203..225 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 226..248 | CDD:275380 | 7/21 (33%) | ||
CG11099 | NP_001286627.1 | leucine-rich repeat | 4..25 | CDD:275380 | |
LRR_8 | 26..82 | CDD:290566 | 16/55 (29%) | ||
leucine-rich repeat | 26..48 | CDD:275380 | 5/21 (24%) | ||
LRR | <43..>194 | CDD:227223 | 44/158 (28%) | ||
LRR_4 | 47..87 | CDD:289563 | 12/39 (31%) | ||
leucine-rich repeat | 49..71 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 72..95 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 96..117 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 118..140 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 141..164 | CDD:275380 | 6/23 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45467249 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |