DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32687 and Phlpp

DIOPT Version :10

Sequence 1:NP_727428.1 Gene:CG32687 / 31980 FlyBaseID:FBgn0052687 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_609938.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster


Alignment Length:300 Identity:84/300 - (28%)
Similarity:134/300 - (44%) Gaps:68/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 MLLNHNRLVGLPRLLLQFGNLKILD-------------LSSNAITTLPD---AVCQLPLVTLIAK 100
            :||.:.|:..|..|.|.:.:||.||             |.||.:.:|||   ||....|.||...
  Fly   174 VLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVS 238

  Fly   101 NNLLTNASLPKSLLTKMANGNGNGNATGGTNSTLKELNLSGNQLTHFPEQVTELRH----LKYLY 161
            .|.|       |.|.:....|         ::.|..|:|:||   |..:.:.|..|    |:.|:
  Fly   239 CNKL-------STLPRYEQNN---------HAALVNLSLAGN---HLNDSIFEPLHNAAKLRVLH 284

  Fly   162 LGGNKISSV-SKDIWKMQSLHVLSLGGNLISEVPEAVGSLNQLQALVLCDNLIEILPTSIARLKN 225
            |..|:|..: :..:.....|.:|.|.||::.::||.|.:|.||:.|..|:||:...| .:|:|..
  Fly   285 LAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTP-QLAKLAM 348

  Fly   226 LKSLLLHKNRLRHLPKDIVAL---KNLTELSLRDN-PLVV-----RFVQDMALKPPTLLELAG-- 279
            ||.|.|..|.|..:  :::||   :||..|.|..| .|.|     :..|..:.:..:|::::|  
  Fly   349 LKVLDLSHNHLDRV--NLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNN 411

  Fly   280 -------RMVKASGQR-----PGPYDIPRTLAEYLNSANC 307
                   ::.:.|.||     .||:.:  ..||...|.:|
  Fly   412 RAALPTTKIRQVSAQRNQNKTSGPWTM--GFAETPGSGDC 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32687NP_727428.1 LRR <66..>259 CDD:443914 65/217 (30%)
leucine-rich repeat 72..92 CDD:275380 12/35 (34%)
leucine-rich repeat 94..133 CDD:275380 8/38 (21%)
leucine-rich repeat 134..156 CDD:275380 7/21 (33%)
leucine-rich repeat 157..179 CDD:275380 5/22 (23%)
leucine-rich repeat 180..202 CDD:275380 9/21 (43%)
leucine-rich repeat 203..225 CDD:275380 8/21 (38%)
leucine-rich repeat 226..248 CDD:275380 8/24 (33%)
PhlppNP_609938.1 LRR 82..>381 CDD:443914 69/228 (30%)
leucine-rich repeat 91..110 CDD:275380
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380 3/8 (38%)
leucine-rich repeat 184..209 CDD:275380 7/24 (29%)
leucine-rich repeat 210..230 CDD:275380 8/19 (42%)
leucine-rich repeat 232..255 CDD:275380 8/38 (21%)
leucine-rich repeat 256..276 CDD:275380 7/22 (32%)
leucine-rich repeat 280..303 CDD:275380 5/22 (23%)
leucine-rich repeat 304..348 CDD:275380 18/44 (41%)
leucine-rich repeat 349..372 CDD:275380 8/24 (33%)
PP2Cc 461..655 CDD:469621
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.