DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32687 and Lrr47

DIOPT Version :9

Sequence 1:NP_001259412.1 Gene:CG32687 / 31980 FlyBaseID:FBgn0052687 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001260355.1 Gene:Lrr47 / 34449 FlyBaseID:FBgn0010398 Length:428 Species:Drosophila melanogaster


Alignment Length:368 Identity:90/368 - (24%)
Similarity:146/368 - (39%) Gaps:96/368 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KTLDFGRMSLDLVTLEDHL----ASPQKA-------LLKSS--------GDIETMLLNHNRLVGL 62
            :||..|....|.:.|..::    |.||||       :.|.|        ..::::.:|:::||.|
  Fly   105 QTLKLGMDGKDAINLRLNINAATAIPQKAQPQVRMVISKRSEYPIKGFPRTLKSLTINNSQLVKL 169

  Fly    63 PRLLLQFGNLKILDLSSNAITTLPDAVCQLPLVTLIAKNNLLTNASLPKSLLTKMANGNGNGNA- 126
            ...:....||..||:|.|.:|.:|..:.:|||.:|...||||                 |..|. 
  Fly   170 SFEICTLRNLTKLDVSGNKLTKIPSELGRLPLTSLHLGNNLL-----------------GTQNDW 217

  Fly   127 --TGGTN--STLKELNLSGNQLTHFPEQVTELRHLKYLYLGGNKISSVSKDIWKMQSLHVLSLGG 187
              ..||.  .:|.||:||||.||:||..:.                       |.:||..|:|..
  Fly   218 CWLRGTKLCQSLGELDLSGNGLTYFPPPLV-----------------------KFESLVSLNLNN 259

  Fly   188 NLISEVPEAVGSLNQLQALVLCDNLIEILPTSIARLKNLKSLLLHKNRLRHLPKDIVALKNLTEL 252
            ||:|.:|.|:..:..|:.|.:|.|.:|.||:::..|: :..|.:..|..:....|  |.:.:   
  Fly   260 NLLSRLPFAIRRMKALRKLYVCSNELESLPSAVEDLR-IDLLDVWGNCFKEFNAD--AAQQM--- 318

  Fly   253 SLRDNPLVVRFVQDMALKPPTLLELAGRMVKASGQRP-GPYDIPRTLAEYLNSANCCVNPNCKGV 316
                      ::|..|...|..|.|.|.........| ....||..|.:.:..|..|   .|..:
  Fly   319 ----------YLQKAASNSPQPLWLLGARAVDKYMLPLSAGSIPAVLIDLIREAPRC---PCGEL 370

  Fly   317 FFDNRVEHI-------KFV-----DFCGKYRVPLLQYLCSSKC 347
            .:..|.|.:       ||:     .:..::::.....||.|:|
  Fly   371 CYAQRKEDLFQRVVQPKFITVKNLTYSREHQIYADVVLCDSRC 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32687NP_001259412.1 leucine-rich repeat 72..92 CDD:275380 7/19 (37%)
leucine-rich repeat 94..133 CDD:275380 10/43 (23%)
LRR_8 132..190 CDD:290566 17/57 (30%)
LRR_4 134..171 CDD:289563 11/36 (31%)
leucine-rich repeat 134..156 CDD:275380 11/21 (52%)
leucine-rich repeat 157..179 CDD:275380 1/21 (5%)
leucine-rich repeat 180..202 CDD:275380 8/21 (38%)
LRR_8 202..259 CDD:290566 12/56 (21%)
leucine-rich repeat 203..225 CDD:275380 8/21 (38%)
leucine-rich repeat 226..248 CDD:275380 4/21 (19%)
Lrr47NP_001260355.1 LRR_8 154..211 CDD:290566 18/56 (32%)
LRR_4 156..194 CDD:289563 11/37 (30%)
leucine-rich repeat 156..178 CDD:275380 4/21 (19%)
leucine-rich repeat 179..199 CDD:275380 7/19 (37%)
leucine-rich repeat 201..228 CDD:275380 10/43 (23%)
leucine-rich repeat 229..274 CDD:275380 21/67 (31%)
leucine-rich repeat 275..298 CDD:275380 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.