Sequence 1: | NP_001259412.1 | Gene: | CG32687 / 31980 | FlyBaseID: | FBgn0052687 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104610.1 | Gene: | Lrrc10b / 278795 | MGIID: | 2685551 | Length: | 292 | Species: | Mus musculus |
Alignment Length: | 262 | Identity: | 66/262 - (25%) |
---|---|---|---|
Similarity: | 99/262 - (37%) | Gaps: | 81/262 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 LDLSSNAITTLPDAVCQLPLVTLIAKNNLLTNASLPKSLLTKMANGNGNGNATGGTNSTLKELNL 139
Fly 140 SGNQLTHFPEQVTELRHLKY-----------------------LYLGGNKISSVSKDIWKMQSLH 181
Fly 182 VLSLGGNLISEVPEAVGSLNQLQALVLCDNLIEILPTSIARLKNLKSLLLHKNRLRHLPKDIVAL 246
Fly 247 KNLTELSLRDNPL-------------VVRFVQDMALKPPTLLE---LAGR-MVKASGQRPGPYDI 294
Fly 295 PR 296 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32687 | NP_001259412.1 | leucine-rich repeat | 72..92 | CDD:275380 | 8/16 (50%) |
leucine-rich repeat | 94..133 | CDD:275380 | 0/38 (0%) | ||
LRR_8 | 132..190 | CDD:290566 | 25/80 (31%) | ||
LRR_4 | 134..171 | CDD:289563 | 17/59 (29%) | ||
leucine-rich repeat | 134..156 | CDD:275380 | 9/21 (43%) | ||
leucine-rich repeat | 157..179 | CDD:275380 | 8/44 (18%) | ||
leucine-rich repeat | 180..202 | CDD:275380 | 6/21 (29%) | ||
LRR_8 | 202..259 | CDD:290566 | 18/56 (32%) | ||
leucine-rich repeat | 203..225 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 226..248 | CDD:275380 | 6/21 (29%) | ||
Lrrc10b | NP_001104610.1 | leucine-rich repeat | 24..45 | CDD:275380 | 9/57 (16%) |
leucine-rich repeat | 46..91 | CDD:275380 | 11/44 (25%) | ||
LRR_8 | 90..148 | CDD:290566 | 20/57 (35%) | ||
LRR_4 | 90..129 | CDD:289563 | 13/38 (34%) | ||
leucine-rich repeat | 92..114 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 115..137 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 138..160 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 161..183 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 184..205 | CDD:275380 | 5/20 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45752 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |