DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32687 and Lrrc10b

DIOPT Version :9

Sequence 1:NP_001259412.1 Gene:CG32687 / 31980 FlyBaseID:FBgn0052687 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001104610.1 Gene:Lrrc10b / 278795 MGIID:2685551 Length:292 Species:Mus musculus


Alignment Length:262 Identity:66/262 - (25%)
Similarity:99/262 - (37%) Gaps:81/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LDLSSNAITTLPDAVCQLPLVTLIAKNNLLTNASLPKSLLTKMANGNGNGNATGGTNSTLKELNL 139
            |:||...:..||.|||.|                                       |.|::|.:
Mouse    26 LELSGRRLRRLPSAVCAL---------------------------------------SR
LQKLYV 51

  Fly   140 SGNQLTHFPEQVTELRHLKY-----------------------LYLGGNKISSVSKDIWKMQSLH 181
            ||..|...||::.|||.|:.                       ||||||::.::..|..::|||.
Mouse    52 SGTGLRELPEEIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPPDFAQLQSLR 116

  Fly   182 VLSLGGNLISEVPEAVGSLNQLQALVLCDNLIEILPTSIARLKNLKSLLLHKNRLRHLPKDIVAL 246
            .|.:.||.:...|..:..|..||:|.:.||.:..||..:.|:..|:.|.|:.||....|..::.:
Mouse   117 CLWIEGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRM 181

  Fly   247 KNLTELSLRDNPL-------------VVRFVQDMALKPPTLLE---LAGR-MVKASGQRPGPYDI 294
            ..|..|.|..|.|             |..:..:....||.:.:   |.|. .|:...:|..|  |
Mouse   182 GRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPPRVADTVFLVGEGAVERMAERDEP--I 244

  Fly   295 PR 296
            ||
Mouse   245 PR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32687NP_001259412.1 leucine-rich repeat 72..92 CDD:275380 8/16 (50%)
leucine-rich repeat 94..133 CDD:275380 0/38 (0%)
LRR_8 132..190 CDD:290566 25/80 (31%)
LRR_4 134..171 CDD:289563 17/59 (29%)
leucine-rich repeat 134..156 CDD:275380 9/21 (43%)
leucine-rich repeat 157..179 CDD:275380 8/44 (18%)
leucine-rich repeat 180..202 CDD:275380 6/21 (29%)
LRR_8 202..259 CDD:290566 18/56 (32%)
leucine-rich repeat 203..225 CDD:275380 8/21 (38%)
leucine-rich repeat 226..248 CDD:275380 6/21 (29%)
Lrrc10bNP_001104610.1 leucine-rich repeat 24..45 CDD:275380 9/57 (16%)
leucine-rich repeat 46..91 CDD:275380 11/44 (25%)
LRR_8 90..148 CDD:290566 20/57 (35%)
LRR_4 90..129 CDD:289563 13/38 (34%)
leucine-rich repeat 92..114 CDD:275380 7/21 (33%)
leucine-rich repeat 115..137 CDD:275380 6/21 (29%)
leucine-rich repeat 138..160 CDD:275380 8/21 (38%)
leucine-rich repeat 161..183 CDD:275380 6/21 (29%)
leucine-rich repeat 184..205 CDD:275380 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45752
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.