Sequence 1: | NP_001259412.1 | Gene: | CG32687 / 31980 | FlyBaseID: | FBgn0052687 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001366558.1 | Gene: | Lrrc39 / 109245 | MGIID: | 1924557 | Length: | 355 | Species: | Mus musculus |
Alignment Length: | 261 | Identity: | 73/261 - (27%) |
---|---|---|---|
Similarity: | 136/261 - (52%) | Gaps: | 22/261 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEVYTSDSSDTDSREQKTLDFGRMSLDLVTLEDHLASPQKALLKSSGDIETMLLNHNRLVGLPRL 65
Fly 66 LLQFGNLKILDLSSNAITTLPDAVCQLP-LVTLIAKNNLLTNASLPKSLLTKMANGNGNGNATGG 129
Fly 130 TNSTLKELNLSGNQ-LTHFPEQVTELRHLKYLYLGGNKISSVSKDIWKMQSLHVLSLGGNLISEV 193
Fly 194 PEAVGSLNQLQALVLCDNLIEILPTSIARLKNLKSLLLHKNRLRHLPKDIVALKNLTELSLRDNP 258
Fly 259 L 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32687 | NP_001259412.1 | leucine-rich repeat | 72..92 | CDD:275380 | 8/19 (42%) |
leucine-rich repeat | 94..133 | CDD:275380 | 9/38 (24%) | ||
LRR_8 | 132..190 | CDD:290566 | 15/58 (26%) | ||
LRR_4 | 134..171 | CDD:289563 | 10/37 (27%) | ||
leucine-rich repeat | 134..156 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 157..179 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 180..202 | CDD:275380 | 5/21 (24%) | ||
LRR_8 | 202..259 | CDD:290566 | 21/56 (38%) | ||
leucine-rich repeat | 203..225 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 226..248 | CDD:275380 | 6/21 (29%) | ||
Lrrc39 | NP_001366558.1 | LRR | 19..>286 | CDD:227223 | 73/261 (28%) |
LRR 1 | 84..105 | 3/20 (15%) | |||
leucine-rich repeat | 85..107 | CDD:275380 | 4/21 (19%) | ||
LRR 2 | 107..128 | 8/20 (40%) | |||
leucine-rich repeat | 108..127 | CDD:275380 | 8/18 (44%) | ||
LRR 3 | 130..152 | 8/33 (24%) | |||
leucine-rich repeat | 131..153 | CDD:275380 | 9/38 (24%) | ||
LRR 4 | 153..176 | 5/22 (23%) | |||
leucine-rich repeat | 154..177 | CDD:275380 | 6/22 (27%) | ||
LRR 5 | 177..198 | 4/20 (20%) | |||
leucine-rich repeat | 178..200 | CDD:275380 | 5/21 (24%) | ||
LRR 6 | 200..221 | 5/20 (25%) | |||
leucine-rich repeat | 201..223 | CDD:275380 | 5/21 (24%) | ||
LRR 7 | 223..244 | 8/20 (40%) | |||
leucine-rich repeat | 224..246 | CDD:275380 | 8/21 (38%) | ||
LRR 8 | 246..267 | 7/20 (35%) | |||
leucine-rich repeat | 247..269 | CDD:275380 | 6/21 (29%) | ||
LRR 9 | 269..290 | 7/12 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |