DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP4R2r and AT5G17070

DIOPT Version :9

Sequence 1:NP_525083.2 Gene:PPP4R2r / 31979 FlyBaseID:FBgn0030208 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_197209.2 Gene:AT5G17070 / 831570 AraportID:AT5G17070 Length:277 Species:Arabidopsis thaliana


Alignment Length:295 Identity:70/295 - (23%)
Similarity:112/295 - (37%) Gaps:84/295 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ERFTDLKQKEIPKELEEYLQYVAKTGDTIFKWSSLKYLFREKLLSVIKHFNE----DSPRLEEIP 75
            |:..|:.::|:.:.||.    ||.||.....|..||......|..|:..::|    |..:.|.:.
plant    52 EQIADMSEEEVKRTLEA----VASTGKFWQDWEILKGTLSYWLKKVLSEYSEAKMTDEQQKEALG 112

  Fly    76 NYPNVDPFNYETMKSSLLERLD-----LFNAAPFTVQRLCELLIDPRKQYSRIDKFMRALEKNIL 135
                 :|:      |.|:.|||     ..:..|||:|||||:|:..|..|.::.|...|||||:|
plant   113 -----EPY------SELVSRLDEALLRFDDGPPFTLQRLCEILLAARSIYPKLSKLALALEKNLL 166

  Fly   136 VVSTI----DPGRKRTESENGDSLDSVVNGDLSMEVNIDIEMENNNGNADEGSSPGAGSAGCAQK 196
            |.|.:    :|..:.||..|..:.:::.:. .|.:.|:   :|:..|:.||              
plant   167 VTSMLAISTEPQSQTTEDPNTATSETITSA-ASCDPNV---IESMGGDKDE-------------- 213

  Fly   197 ASCPRSDDNDQPKAKKAKLEIDGEERSEASDETDTEVATRVKNEKDEKNDNDETDSPHEAAEIEE 261
                            ...|:         :|.|.:.|..|        |.:..|.|.|......
plant   214 ----------------IMTEV---------EEADVDDAMTV--------DMETIDEPSETMTTTS 245

  Fly   262 PDEEVDEADQETKTTKQPAYGSQKEGEQEESFPSS 296
            ..|.:.|     .|..||...|....|.:...|::
plant   246 ESETLSE-----NTAAQPLSDSMVAEEGDSRLPTT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP4R2rNP_525083.2 PPP4R2 10..292 CDD:286293 69/289 (24%)
AT5G17070NP_197209.2 PPP4R2 69..>236 CDD:286293 54/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3827
eggNOG 1 0.900 - - E1_KOG3175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004686
OrthoInspector 1 1.000 - - oto4071
orthoMCL 1 0.900 - - OOG6_104211
Panther 1 1.100 - - LDO PTHR16487
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.