DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and DNAJA3

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_005138.3 Gene:DNAJA3 / 9093 HGNCID:11808 Length:480 Species:Homo sapiens


Alignment Length:386 Identity:105/386 - (27%)
Similarity:154/386 - (39%) Gaps:101/386 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNK-SPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            :|||:|||:.|.|:..||:|||::.|.:||||.|| .|:|:|.|.|:|:|||||||:.||..|| 
Human    92 EDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYD- 155

  Fly    67 RNDKGTRRNTANQGSGFGDGTAFGSCG---GGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYST 128
                                 |:||.|   |.|||......||... :|...|.:.|  .|..|:
Human   156 ---------------------AYGSAGFDPGASGSQHSYWKGGPTV-DPEELFRKIF--GEFSSS 196

  Fly   129 FFEDIENDFDSDDDVLL-----GGGAGAPKR-------RCEQ-----QSPQSSIEHVIYV---AL 173
            .|.|.:..||...:..:     ....|..|.       .||:     ..|.:.::|..|.   .:
Human   197 SFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGM 261

  Fly   174 EDIANG-CNRRMKISRASGRNGV------------DGVQYDRILTVKIPPGCKAGTKICFPNEGI 225
            |.|..| ...|....|..||..:            ...|..|:: :.:|.|.:.|..:..|    
Human   262 ETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQKKRVM-IPVPAGVEDGQTVRMP---- 321

  Fly   226 QLPNLEPANVVFIIRDKPHPIFRRDGNNLLYTAEISLKDALCG-----------LHVMVPTLLGR 279
                :....:....|.:..|:|||||.::.....||:..||.|           ::|.:|.  |.
Human   322 ----VGKREIFITFRVQKSPVFRRDGADIHSDLFISIAQALLGGTARAQGLYETINVTIPP--GT 380

  Fly   280 PMELKTDVGEVISPKSVRRILGYGLPDSINNSRRGSIVVRFSIQFPDAISKELASSLDRLL 340
            ..:.|..:|            |.|:| .||:...|...:...|:.|    |.|.|....|:
Human   381 QTDQKIRMG------------GKGIP-RINSYGYGDHYIHIKIRVP----KRLTSRQQSLI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 101/375 (27%)
DnaJ 4..65 CDD:278647 35/61 (57%)
DnaJ_C 163..326 CDD:199909 39/189 (21%)
DNAJA3NP_005138.3 DnaJ 90..480 CDD:223560 105/386 (27%)
DnaJ 93..155 CDD:278647 35/61 (57%)
DnaJ_C 207..416 CDD:199909 46/236 (19%)
DnaJ_zf 236..296 CDD:199908 12/59 (20%)
CXXCXGXG motif 236..243 2/6 (33%)
CXXCXGXG motif 253..260 1/6 (17%)
CXXCXGXG motif 275..282 2/6 (33%)
CXXCXGXG motif 289..296 0/6 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.