Sequence 1: | NP_572633.1 | Gene: | CG2887 / 31978 | FlyBaseID: | FBgn0030207 | Length: | 342 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_013884.1 | Gene: | HLJ1 / 855196 | SGDID: | S000004771 | Length: | 224 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 214 | Identity: | 62/214 - (28%) |
---|---|---|---|
Similarity: | 90/214 - (42%) | Gaps: | 63/214 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYD--- 65
Fly 66 ---------SRNDKGTRRNTAN---QGSGFGDGTAFGSCGGGSGSG-----------SGGGSGGG 107
Fly 108 RQNNPRA---NFG-----RFFDNSESYSTFFEDIENDFDSDDDVLLGGGAGAPKRRCEQQSPQSS 164
Fly 165 ----------IEHVIYVAL 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2887 | NP_572633.1 | DnaJ | 1..331 | CDD:223560 | 62/214 (29%) |
DnaJ | 4..65 | CDD:278647 | 30/60 (50%) | ||
DnaJ_C | 163..326 | CDD:199909 | 2/21 (10%) | ||
HLJ1 | NP_013884.1 | DnaJ_bact | 22..>154 | CDD:274090 | 48/132 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |