DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnaja2

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_114468.2 Gene:Dnaja2 / 84026 RGDID:71001 Length:412 Species:Rattus norvegicus


Alignment Length:364 Identity:115/364 - (31%)
Similarity:176/364 - (48%) Gaps:47/364 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDSRNDK 70
            |.|||:...|::.|::|||.|.|..||||||  |.|.:.||:::.||||||:.:||..||...::
  Rat    10 YDILGVPPGASENELKKAYRKLAKEYHPDKN--PNAGDKFKEISFAYEVLSNPEKRELYDRYGEQ 72

  Fly    71 GTRRNTANQGSGFGDGTAFGSCGGGSGSGS------GGGSGG--GRQNNPRANFGRFFDNSESYS 127
            |.|     :||           |||.|...      |||..|  |.|:..|....|..|......
  Rat    73 GLR-----EGS-----------GGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLK 121

  Fly   128 TFFEDIEN----DFDSDDDVLL------GGGAGAPKR--RCEQQSPQSSIEHV---IYVALEDIA 177
            ...||:.|    ......:||.      ||.:||.::  .|..:..:..|..:   :...::.:.
  Rat   122 VSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVC 186

  Fly   178 NGCNRRMKISRASGR----NGVDGVQYDRILTVKIPPGCKAGTKICFPNEGIQLPNLEPANVVFI 238
            :.||...::.....|    .|...::..:||.|.:..|.|.|.:|.|..|..|.|.:||.::|.:
  Rat   187 SDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLL 251

  Fly   239 IRDKPHPIFRRDGNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPKSVRRILGYG 303
            :::|.|.:|:||||:|..|.:|.|.:||||.......|..|.:.:|...|:||.|..||.:.|.|
  Rat   252 LQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGCVRVVRGEG 316

  Fly   304 LPDSINNSRRGSIVVRFSIQFPDA--ISKELASSLDRLL 340
            :|...|...:|.:.::|.:|||:.  |:.:..|.|:.||
  Rat   317 MPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 111/353 (31%)
DnaJ 4..65 CDD:278647 29/58 (50%)
DnaJ_C 163..326 CDD:199909 51/169 (30%)
Dnaja2NP_114468.2 PTZ00037 4..412 CDD:240236 115/364 (32%)
CXXCXGXG motif 143..150 0/6 (0%)
CXXCXGXG motif 159..166 1/6 (17%)
CXXCXGXG motif 186..193 2/6 (33%)
CXXCXGXG motif 202..209 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.