DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and DNAJC5

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_079495.1 Gene:DNAJC5 / 80331 HGNCID:16235 Length:198 Species:Homo sapiens


Alignment Length:67 Identity:28/67 - (41%)
Similarity:43/67 - (64%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKILGIQRTANDGEIRKAYHKQALRYHPDKN-KSPQAEEIFKQVAKAYEVLSDKKKRGSYDSRND 69
            |.:||:.:.|...:|:|:|.|.||:|||||| .:|:|.:.||::..|:.:|:|..||..||....
Human    17 YHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGS 81

  Fly    70 KG 71
            .|
Human    82 LG 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 28/67 (42%)
DnaJ 4..65 CDD:278647 25/59 (42%)
DnaJ_C 163..326 CDD:199909
DNAJC5NP_079495.1 DnaJ 15..>84 CDD:223560 28/67 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.