DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajc21

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_084322.2 Gene:Dnajc21 / 78244 MGIID:1925371 Length:531 Species:Mus musculus


Alignment Length:101 Identity:39/101 - (38%)
Similarity:57/101 - (56%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYD 65
            |.:|:.||::|.|::.|::|||.|.|||:|||||  .:.:|.|.||.:..||:||||.::|..||
Mouse     2 KCHYEALGVRRDASEEELKKAYRKLALRWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQERAWYD 66

  Fly    66 SRND---KG-------------TRRNTANQGSGFGD 85
            :..:   ||             ....|....||:||
Mouse    67 NHREALLKGGLDGEYQDDSLDLLHYFTVTCYSGYGD 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 39/101 (39%)
DnaJ 4..65 CDD:278647 29/62 (47%)
DnaJ_C 163..326 CDD:199909
Dnajc21NP_084322.2 DnaJ 3..66 CDD:278647 29/62 (47%)
DBINO <181..243 CDD:290603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..309
zf-C2H2_jaz 314..339 CDD:288983
C2H2 Zn finger 316..338 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 507..531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.