DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnajc11

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001072583.1 Gene:dnajc11 / 780038 XenbaseID:XB-GENE-942676 Length:559 Species:Xenopus tropicalis


Alignment Length:363 Identity:77/363 - (21%)
Similarity:132/363 - (36%) Gaps:115/363 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSP----QAEEIFKQVAKAYEVLSDKKKRGSY 64
            |||.:|.::|.|...|::.:|.:..:.|||||::.|    |||::|..|.:|||||||.:.|..|
 Frog    14 DYYSLLNVRREATQEELKASYRRLCMLYHPDKHRDPELKKQAEQLFNLVHQAYEVLSDPQSRAIY 78

  Fly    65 DSRNDKG---------TRRNTAN------------------QGSGFGDGTAFGSCGGGSGSGSGG 102
            |....||         .|:.||.                  |                       
 Frog    79 DIYGKKGLEMEGWEVVERKRTAAEIREEFERLQREREERRLQ----------------------- 120

  Fly   103 GSGGGRQNNPRANFGRFFDNSESYSTFFEDIENDFDSDDDVLLGGGAGAPKRRCEQQSPQSSIEH 167
                 ::.||:.......|.:|.:..:.||.|       |:   .|:|.|:....:.....|||.
 Frog   121 -----QRTNPKGTISVGIDATELFDRYDEDFE-------DI---PGSGFPQIEINRMHISQSIEA 170

  Fly   168 VIYVALEDIANGCNRRMKISRASGRNGVDGVQYDRILTVKIPPGCKAGTKICFPNEGIQLPNLEP 232
            .:......|.:|     .:|..:| ||...:.    |.::.....|...::.|....:|.|    
 Frog   171 PLTATDTAILSG-----SLSTQNG-NGGGSIN----LALRRVTSAKGWGELEFGAGDLQGP---- 221

  Fly   233 ANVVFIIRDKPHPIFRRDGNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPKSVR 297
               :|.::     |||.......:|...:|:.:..|:...:.|::.|.::..|            
 Frog   222 ---LFGLK-----IFRNLTPKCFFTTNCALQFSSRGIRPGLTTMVARNLDKNT------------ 266

  Fly   298 RILGY-----GLPDSINNS-----RRGSIVVRFSIQFP 325
              :||     |:..::|.|     :.....:.|.:..|
 Frog   267 --MGYIQWRWGIQSAMNTSIVRDTKNSHFTLAFQLGIP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 77/363 (21%)
DnaJ 4..65 CDD:278647 27/64 (42%)
DnaJ_C 163..326 CDD:199909 31/173 (18%)
dnajc11NP_001072583.1 DnaJ 14..79 CDD:365959 27/64 (42%)
DUF3395 410..549 CDD:371774
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.