DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and DNAJC7

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_003306.3 Gene:DNAJC7 / 7266 HGNCID:12392 Length:494 Species:Homo sapiens


Alignment Length:115 Identity:46/115 - (40%)
Similarity:63/115 - (54%) Gaps:19/115 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQA------EEIFKQVAKAYEVLSDKKKR 61
            ||||||||:.:.|::.||:|||.|:||.:|||::....|      |:.||:|.:|:.:|||.||:
Human   380 KDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKK 444

  Fly    62 GSYDSRNDKGTRRNTANQGSGFGD-------GTAFGSCGGGSGSGSGGGS 104
            ..|||..|      ...:|...||       ...||..||.|...||.|:
Human   445 TRYDSGQD------LDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGN 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 46/115 (40%)
DnaJ 4..65 CDD:278647 30/66 (45%)
DnaJ_C 163..326 CDD:199909
DNAJC7NP_003306.3 3a0801s09 19..>353 CDD:273380
TPR 1 28..61
TPR repeat 28..56 CDD:276809
TPR repeat 61..91 CDD:276809
TPR 2 62..95
TPR 3 96..129
TPR repeat 96..124 CDD:276809
TPR 4 142..175
TPR repeat 145..170 CDD:276809
TPR repeat 175..205 CDD:276809
TPR 5 177..209
TPR 6 210..243
TPR repeat 210..238 CDD:276809
PLN03088 253..>353 CDD:215568
TPR 7 256..289
TPR repeat 257..284 CDD:276809
TPR repeat 289..323 CDD:276809
TPR 8 294..327
TPR 9 328..361
TPR repeat 328..356 CDD:276809
DnaJ 380..>469 CDD:223560 38/94 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.